SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_0818 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_0818
Domain Number 1 Region: 106-179
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000471
Family GIY-YIG endonuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_0818
Sequence length 184
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MNEKIKAFSKSATLPLLRVSETGVKEFYQFEIDCFEMKDYNFINVLKEGDFAHLFDKVVN
ICGPCLYYFEIESDHTADDIVSRIQNYKLIPGAKSVPAIKKKIPQSKVLYVGKVKKGLWG
RLVQHLGYYKVSRTQGLQLFYWTQGTNMKLKMHVLEFENEMADYMSVLEIKLAKDLNPIL
GKHD
Download sequence
Identical sequences Q11WW1
WP_011584221.1.19587 WP_011584221.1.79486 269798.CHU_0818 gi|110637238|ref|YP_677445.1| 2005358406 2005407796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]