SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_0642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269799.Gmet_0642
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily Translational machinery components 1e-52
Family Ribosomal protein L18 and S11 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_0642
Sequence length 121
Comment (Geobacter metallireducens GS-15)
Sequence
MSPLAQKKVAHLKRKTRVRKKIRGTTDRPRLNVYKSARHIYAQIIDDVTGVTLVSASTVQ
DESDALKYTGNVEAAKCVGAMVAKKALEKNITSVVFDRNGFLYHGRVKALADSARENGLS
F
Download sequence
Identical sequences Q39XZ0
269799.Gmet_0642 WP_004514252.1.25803 WP_004514252.1.48315 gi|404495500|ref|YP_006719606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]