SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_1591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269799.Gmet_1591
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-49
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 294-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-48
Family Ribonuclease PH domain 1-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 448-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.52e-29
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.91e-26
Family Ribonuclease PH domain 2-like 0.0032
Further Details:      
 
Domain Number 5 Region: 552-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.88e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 
Domain Number 6 Region: 618-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.03e-20
Family Cold shock DNA-binding domain-like 0.0006
Further Details:      
 
Domain Number 7 Region: 237-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.67e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_1591
Sequence length 697
Comment (Geobacter metallireducens GS-15)
Sequence
MNEQKVNVDFGGRTITIATGKMAKQASGAVMVSCGETMVLVTAVALKSAKEGQDFFPLTV
NYQEKAYAGGKIPGGFFKREGRPTENETLTCRFIDRPIRPLFPENFLNDTQIMATVVSAD
QDNDPGILAMIGASAALEVSDIPFFGPIAGVKVGRVDGKFICNPTAEQLAASDLEVVVAA
SRDAVIMVEGGAAEISEADLLEAIFFGHASVQPIIDAQIELRKQAGVPKREIAPPAVDEA
LGAKVKELAYAQMKDAVRIRSKQERHNRISAIADETVAALEADFSGRGAEIKDFLDGFEY
ELVREHILKDGERIDGRDTKTIRPITSEVGILPRVHGSALFTRGETQALVAATLGTSSDE
QRIDSLYGESRKRFMLHYNFPPFSVGETSFRLAPGRREIGHGYLAERALERVLPKHDDFP
YTIRIVSDILESNGSSSMASVCGGALSMMDAGVPISAPVAGIAMGLIKEGDDIAILSDIL
GDEDHLGDMDFKVAGTSTGVTAIQMDIKITGVTREIMGKALEQAKEGRLHILGKMAEALA
APRTDLSPYAPRITTIWVKTDKIRDVIGAGGKNVRGITEATGVSIDIEDTGKINIASTNK
EACDKAIKMIRDLTAEAEEGKLYMGTVRKVMDFGAFVEIFPGTDGLVHISELDTERVKDV
TDILKEGDKVLVKCIGIDKQGKIKLSRKEALGAVLPE
Download sequence
Identical sequences Q39VA1
269799.Gmet_1591 WP_004511474.1.25803 WP_004511474.1.48315 gi|404496453|ref|YP_006720559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]