SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_2469 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269799.Gmet_2469
Domain Number 1 Region: 2570-2783
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-34
Family Clostridium neurotoxins, the second last domain 0.066
Further Details:      
 
Domain Number 2 Region: 2823-2996
Classification Level Classification E-value
Superfamily Fibronectin type III 3.57e-18
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 3309-3501
Classification Level Classification E-value
Superfamily Fibronectin type III 9.13e-17
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 4 Region: 481-579
Classification Level Classification E-value
Superfamily Fibronectin type III 9.95e-17
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 1120-1318
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000032
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 6 Region: 2301-2483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000147
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 7 Region: 1708-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000401
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 8 Region: 1317-1394
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000324
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 9 Region: 714-985
Classification Level Classification E-value
Superfamily NHL repeat 0.00000214
Family NHL repeat 0.0092
Further Details:      
 
Domain Number 10 Region: 2120-2202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000276
Family Fibronectin type III 0.006
Further Details:      
 
Weak hits

Sequence:  269799.Gmet_2469
Domain Number - Region: 1040-1105
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000129
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number - Region: 62-343
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000785
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number - Region: 2199-2292
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0201
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number - Region: 3087-3165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0353
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_2469
Sequence length 3507
Comment (Geobacter metallireducens GS-15)
Sequence
MVIAMIYALRQLVRGTAAGAISRLALLLFFVASMAVPVFGAGGDKLRDAGDTPQAGKQEA
KASVVDGDGRLIVTGYRNLAGLTDDDYWTVKFNPDGTVAWRASYNRAGGSDQATAIAVDS
NNDAIVTGFAWNGSNFDIYTVKYRGSDGAKLWENTYNAPAGGNDIGTAIAVDGLNNVYVG
GSVQNASGNEDYIVLKFGVNGPNPDGTPLWIATWNGTANGTDKLAAIATGPGGVAVTGQS
WNGTDFDVLTIKYDYAGTKLWENRDSSAGTNADAGRKVRVDGSGNVVVAASVNNGTNVDI
YTAKYNGTNGALLWSATYNGPTNMDDEPTALALDGGGNVYVTGYATTLTGNEDLVVIRYD
STNGTKAWDKLYDSGGGGHDFGTDIVLDAGGNVYVGGYTLTGAGTTDMLCIKYQNGAASA
GELWHTAFNGTAGKSDKAVGLGIKTTDNEFVVVVGGWSDVWTAGASDYDYWQVVLDAGSL
NSPGNLTATVLSNTSVKVDWTDNSTNEDGFRIERKLTSEGIWAEVGTVGANVTTFTDTGL
TANSTYYYRVRSYNALNGSSNPSDEISVITLYVNYLAPTWNYVFNSSDNSEDYAEAIAVG
PDNNPVVTGYSLATLTGFDYYTVKLDHTTGALLWSERYNDVDSELDIAKSVVVDGSNTAI
VTGYSSLYYAPAARNINSVFTLKYPAAGGIPLWEGQYNGPGGIDDRARAIATAVDGSNNV
AVVGYGKNAANNDDIYLLKYAATPPLDGFGKAIPAWSATPYDGGGNDYPSAVAFDKDGNI
VITGYRHNGINYDIYTAKYNGATGVKIWDHILDGAGHGDDYGQSLAVDAVGNVYVTGSTR
NAAGNDDIILVKYDGKAVPTASRVIWQKSYDGTTAGNPNADDKGITVKYDLIDDTVVVAG
TTLTGTGDHDFIIIRYSSAGNVVWQKVHLRPSSDDYATAMAMDVSGNVSVVGYTGPASGL
TTDAMAVKFDYAGNLLAATIYNGAANGYDQALAVTVNSLGETLVAGYTTNATGNADYLVF
KGDGTPLQASSPFTASPFYTKADLAWTDTSTGEDGFTIERQVGNCTSSNPWQLLTTTAAN
TTAYSDTGLNVGEEYCYRVRPFKSGQPDQRWIERDIVLTSPPPPSVVTPVAANTTTVNLT
WQDNTTGETGFRIFRCTGSTVSCSAADYAEIGSVASNVTTYSDTGVTAATTYTYKVLSYK
TADWQSQFSTPASATTPTPTAPTGLTATRGSEGQIDLAWSDSNNDESGFKIERCTGSGCS
TFTQIDTVAASATSYSDIVAVQPDTLYRYQIRAYKTSAAGWNGPYSGVAEATTTSAAPSL
TSATAADTTTVSLAWTDTAGSETGYNVERCLGTTCAEQDYSVVVLTAPSATSVSDASACN
STTYTYRVRAVNQGLSRGNGGTWSRKVPLAIANFQPYFQTKVVIPYDADMKADFTDIRFY
DETTQREIPYWIESRTNSTTATFWIKTGGFNTISLYYGNGGATGAGNGPLVFELFDGFAS
AAIDTSKWTTSGAYYSQTGGEFLSSGGPGSWSTGMYSVANFSRPFVFEVNHYRSGGQYMM
PGIKSTTADVSYTDFAYAAYPIYDGGGNRLAVYEDGNSRGDNKKAISSDVWQYFRFEVLP
TTGANYYHGTSSSDATSFYASTYSTAPSFKVGFANYNQVFKLDNARVRKFAAPEPTVTLG
EEAVFGGTFPIMWDGLASNTRSVTTPTPMPPSGFTASRGTEVQIDLAWTDTTSDETGFRI
YRCAGAGCSVFSKVGSDLPANTTSFKDTGLTPGTSYTYKVAAFKTASCGWELESVTSTAQ
TTVLPPAAFAVSPAVTTGCEDIRATESDGTLLSQWVQQLQCNTTGTRIWQKVSSIPVGTK
TLYYYYGNTTAPSVDNGDATFEFFDDFTDTAINGAKWTQTLGSAGNFTVQNGTLRGNNSS
GRLVSTFKMLNGMLATFKVKTTTLAANTHMVGGVYNGTYDYFGISVGPSHGGYNLYGEWI
TAVTTTSVPANNMGYSIYSTDGATTTIQGYNWDTGAWYISPMSKSYSINNKPLGLGLTYY
GDYYGGQAYQTDWYWVLVRKLAAVAPTATAGTKEYGPFTLGGATFAVRIPLTVNHTATGA
AALSNYQAVLPLLDTTPLAVDRITLAWSDNSGSETGFGIERCTGAGCSNFVQIDTSAANT
TSYVDRGVDAAQTYCYRIKTLIPTGDSAYSDVVCKSTSTPAPPAGLVTAVSGTRVDLSWT
DTTTNEDGFQIERCEGLNCDFTTLDSGFPVTIPQNATATVTYSDTTACAGTYMYRVKSIK
PWVTGWPATYTAAVPATLSDPQAPSAFTATAQSEVSVVLGWADNTSDETGFKIERCTGTG
CTTFSQIATVAANVTSYTDYGRLPNTTYRYRVRAYKGGGCGWDTPYSAEQEVATTVPLPT
GLTLTTPSSTQVAASWTDTTFSETSFKIERCQDAGCSTFSEVGSVSAGVTSYTDSSVCSG
TSYTYQVRPVNEGFSSAGGGCWSRRAPLTIANFQPDFLVKLTIPYDADMQADFNDLRFID
QGTGGELPYWIESKTNGATATLWLKTGKTASIYLYYGNPSALAVGSQSGVFGSGLMAYFP
FNENAGTTTGTTKDFSGAGNDLTMNGFSAPYGVVSGGPYGNALSLNGGGAWANRAAPNVP
TGSVATVEAWIYPKVYADASYNGIVSWSSRGCNGLGFALSIQNSGRPSMPTWCNDYVPGS
GATATLNAWNHVAAVLNGQSATLYVNGQQVGATTLPYLPNLSSVNLAVGVLDYPGRYFNG
LIDEVRIYNRALTAQEITSRYAAAIPTVSLGAEEQAGGCYTSDWLYTGQPSATKSITTPT
IAAPTGFSATRGSESQINLTWTDASNDETNFVIERCSGATCDFSGADTIELPAGPTSYND
VGLLPDTTYRYRLHAKRTASCTSYSAYNTNGIVSASTTVLAPTSLTASASSSTSVTLRWT
DNSPSDTGFRIERCMGNPCSNFSLVGYSPGHATSYEDTGVCPGTAYTYQIKAVNVGLSSG
GGGSWTRRKPITIANFQPNFQTKMTVAYDAGMKADFSDIRFFDPATNQELPYWIEKKTDS
STATVWVKTRTSSTIHLYYGNPNAESIASGALVFDFFDDFTDNAIDTTKWTVTDGTGFSV
SGGYLHGTNVTGRLTSKTSYSPGVILDIKAKTTSFAIDGQIIGGFSAGSYNNVGWLEHPA
YVHFINNNSYTAKGGTPTTTANMLYSMAVIDASWVNMQATNFDTGVLYWNAGNVNNGVAA
EPIVLGRRYDTDASNDQPYATDWDWIRVRKYAATEPSATVGAEEQSAGYTFTAGYTGPAS
ATATATTPAPVAPGVLTVTPATDTSLLLGWGDPIPDETRFVIYGCNNGDCSSATQIATVA
GGTAIYTHPGLTPSIQYCYRVKAEKTAACTTGWEALYTNIACGTAISAQPQTLTATPLNA
FTIRLNWADMASDEEGYEIEVKAWNDKWVKTATVGANVTTYVDAIGIEPLKSYTYRVRAY
RGSDKSPYSNTASATTQAYVPGDSNCK
Download sequence
Identical sequences Q39ST0
WP_004512431.1.25803 WP_004512431.1.48315 269799.Gmet_2469 gi|404497325|ref|YP_006721431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]