SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_1213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_1213
Domain Number 1 Region: 43-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.12e-83
Family Xylanase/endoglucanase 11/12 0.0000000162
Further Details:      
 
Domain Number 2 Region: 250-335
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.46e-17
Family Cellulose-binding domain family II 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_1213
Sequence length 338
Comment (Thermobifida fusca YX)
Sequence
MNHAPASLKSRRRFRPRLLIGKAFAAALVAVVTMIPSTAAHAAVTSNETGYHDGYFYSFW
TDAPGTVSMELGPGGNYSTSWRNTGNFVAGKGWATGGRRTVTYSASFNPSGNAYLTLYGW
TRNPLVEYYIVESWGTYRPTGTYMGTVTTDGGTYDIYKTTRYNAPSIEGTRTFDQYWSVR
QSKRTSGTITAGNHFDAWARHGMHLGTHDYMIMATEGYQSSGSSNVTLGTSGGGNPGGGN
PPGGGNPPGGGGCTATLSAGQQWNDRYNLNVNVSGSNNWTVTVNVPWPARIIATWNIHAS
YPDSQTLVARPNGNGNNWGMTIMHNGNWTWPTVSCSAN
Download sequence
Identical sequences Q47QL8 Q56265
WP_011291660.1.82272 gi|72161617|ref|YP_289274.1| 269800.Tfu_1213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]