SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_2174 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_2174
Domain Number 1 Region: 53-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-18
Family Laminin G-like module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_2174
Sequence length 243
Comment (Thermobifida fusca YX)
Sequence
MAEAAGRLPAAAFGRAVRTREGLVTERGRGGGSRRLPSVHERTPMPEPVTIPALPASLTW
WNTPVDFAVTGPDSLCITAGARTDVFSDPNGTVRIANAPALLAGLDGDFTLAARVSPSLH
ATYDAGVLFLYVDEDNHAKLCLELSPQGQPTIVSVVTRDGVSDDCNSLAVEGEAMLRITR
TGGAYAFHTNLGDGWWHLIRYFALPGPARAGFLAQSPTGEGQTVHFTEIAYTSAPPADLR
GGQ
Download sequence
Identical sequences Q47MW2
gi|72162573|ref|YP_290230.1| WP_011292597.1.72373 WP_011292597.1.82272 TfR52 269800.Tfu_2174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]