SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 271848.BTH_I0636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  271848.BTH_I0636
Domain Number 1 Region: 18-71
Classification Level Classification E-value
Superfamily HCP-like 0.00000798
Family HCP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 271848.BTH_I0636
Sequence length 188
Comment (Burkholderia thailandensis E264)
Sequence
MSIRKGCGSRRGRSVRRRSAKAACGLGLRHFRGDGVTQDGCQASARMRAAAEHGNLRVQN
ALGAFYLIGFEEKGSGAREGDRWRSSAAGRGDMESKKLLKQAPRGQARMKMITDDARQGV
TFSPATGIRAIRTSVSGDSRTGIGIDRVPALAGRSQETNSSRALLEWLDAVRANGDGARK
SKTKIRRK
Download sequence
Identical sequences A0A2C5VTS2 Q2T0V6
271848.BTH_I0636 gi|83721291|ref|YP_441193.1| WP_011401823.1.101337 WP_011401823.1.28912 WP_011401823.1.44093 WP_011401823.1.49905 WP_011401823.1.6992 WP_011401823.1.7190 WP_011401823.1.83779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]