SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 271848.BTH_I2028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  271848.BTH_I2028
Domain Number 1 Region: 150-287
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.64e-51
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 56-145
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.62e-26
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00044
Further Details:      
 
Domain Number 3 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000102
Family TS-N domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 271848.BTH_I2028
Sequence length 293
Comment (Burkholderia thailandensis E264)
Sequence
MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEG
VVASFVGANAGALVELNCETDFVAKNDDFNAFAKTVAELVATQNPADVAALSALPLDGKT
VDEVRLALVGKIGENISIRRFVRFETSNKLATYLHGSRIGVIVEYTGEQEQVGKDVAMHV
AAMKPVSLSSDDVPAELIEKERRVAEQKAAESGKPAEIVAKMVDGSVQKFLKEVSLLNQP
FVKNDKQTIEQMLKASNAAVQKFALFVVGEGIEKRQDDFAAEVAAQVAAAKQQ
Download sequence
Identical sequences A0A096YLI2 A0A1B4JWM6 Q2SWZ7
WP_011402238.1.101337 WP_011402238.1.18625 WP_011402238.1.21694 WP_011402238.1.22957 WP_011402238.1.28186 WP_011402238.1.28510 WP_011402238.1.28912 WP_011402238.1.31243 WP_011402238.1.31764 WP_011402238.1.42613 WP_011402238.1.43935 WP_011402238.1.44093 WP_011402238.1.49905 WP_011402238.1.58271 WP_011402238.1.66095 WP_011402238.1.68421 WP_011402238.1.6992 WP_011402238.1.7190 WP_011402238.1.77623 WP_011402238.1.80240 WP_011402238.1.83779 WP_011402238.1.88085 WP_011402238.1.8909 gi|83719639|ref|YP_442552.1| 271848.BTH_I2028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]