SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272557.APE_0103.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272557.APE_0103.1
Domain Number 1 Region: 55-152
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000345
Family HSP20 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272557.APE_0103.1
Sequence length 155
Comment (Aeropyrum pernix)
Sequence
MSEYGFDDEFRRIIMRFYQALREAEETFSTMTRLAIGELREFEELLEQRLQEFQGEGIEP
IVSVDDLGDRLRILIDLPGMDRESLNIVVLEDRVEISARIREHVVKRALGSLSEKFSFRE
YRGVYRLPAPVDPRSVRIRTRGSLIIVEADKKAAV
Download sequence
Identical sequences Q9YFZ9
gi|118430881|ref|NP_146965.2| 272557.APE_0103.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]