SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH0735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272558.BH0735
Domain Number - Region: 31-89
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0955
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272558.BH0735
Sequence length 93
Comment (Bacillus halodurans)
Sequence
METEVQTTTAQSTVHVAEETAPVMKVSEWLITMLLLVIPIVNLIMVCIWAFGGNANPNKE
NYSKAFLIMMAIVVGLYVILLIFFFMFAALLSY
Download sequence
Identical sequences A0A0M0KCD9 Q9KEW4
gi|15613298|ref|NP_241601.1| WP_010896908.1.28103 WP_010896908.1.91347 272558.BH0735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]