SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH0899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH0899
Domain Number 1 Region: 29-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-70
Family Xylanase/endoglucanase 11/12 0.0000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH0899
Sequence length 210
Comment (Bacillus halodurans)
Sequence
MFKFVTKVLTVVIAATISFCLSAVPASANTYWQYWTDGGGTVNATNGPGGNYSVTWRDTG
NFVVGKGWEIGSPNRTIHYNAGVWEPSGNGYLTLYGWTRNQLIEYYVVDNWGTYRPTGTH
RGTVVSDGGTYDIYTTMRYNAPSIDGTQTFQQFWSVRQSKRPTGNNVSITFSNHVNAWRN
AGMNLGSSWSYQVLATEGYQSSGRSNVTVW
Download sequence
Identical sequences A0A0M0KD92 D2KPJ0 G4XVR9 Q71S35 Q79MJ7 Q9KEF3
gi|15613462|ref|NP_241765.1| WP_010897072.1.28103 WP_010897072.1.91347 272558.BH0899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]