SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH0907 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH0907
Domain Number 1 Region: 2-224
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.14e-71
Family Sir2 family of transcriptional regulators 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH0907
Sequence length 237
Comment (Bacillus halodurans)
Sequence
MLTTWLTEAKKIVIFTGAGMSTESGVPDFRSSRGLWQGKNPEALASVDAMDHNREAFIDF
YRMRIEGLQGVRPHKGYDVLAAWEKELPITSIITQNTDGLHEQAGSEVVLPLHGSIQRLY
CVACGQRYDVARYITNEPYCSCGGFIRPAVVLFGEMLNTDTLALAERHTKEADLFLVLGS
SLVVSPANLFPKIAKECGAKLVIVNHDETPLDPLADLVIQDQSIGTFLEETNRALQA
Download sequence
Identical sequences Q9KEE5
272558.BH0907 WP_010897080.1.28103 gi|15613470|ref|NP_241773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]