SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH2095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH2095
Domain Number 1 Region: 14-203
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-62
Family BPHL domain 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272558.BH2095
Sequence length 204
Comment (Bacillus halodurans)
Sequence
MFKKIASDALGISDIGKIIRPEDFDKTESDDYVLHEDGENIHFLIKSKTDEYCFTNRSLI
HLDGAKATSSKRNIYRYDYYLFPIRNIMIETAGTIDLDLEIKFTIGEKAFSVDIDRREGE
AIADLYKSLVAISHIQIEQDRRKDYAKSGLTYSKELFTDNRFHDGTISEEFEKATKFAFD
WLDTTYNENTRKDFGDVFSKYIQN
Download sequence
Identical sequences A0A0M0KJU5 Q9KB40
gi|15614658|ref|NP_242961.1| 272558.BH2095 WP_010898252.1.28103 WP_010898252.1.91347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]