SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH2378 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH2378
Domain Number 1 Region: 317-468
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.41e-31
Family HD domain 0.01
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272558.BH2378
Sequence length 521
Comment (Bacillus halodurans)
Sequence
MEFNVLFISILLVVSAVSAVVGYLVRKSIAEAKISSAEHAAKQIVEDAKREAEAGKKEAI
LEVKDEVHKLRTEAEREIRERRNEIQKQENRLVQKEEILDRKSETLDKKEESLDKREESL
TKKQRQIEEMDSKVEEILNKQQVELERISGFSREEAREVIRAEVEQEMAHETALLIKERV
AKAKEEADKKAREILSLAIQRCSADHVAETTVSVVNLPNDEMKGRIIGREGRNIRALETL
TGIDLIIDDTPEAVILSGFDPIRREIARTALEKLVQDGRIHPARIEEMVDKARREVDEAI
REYGEQTTFEMGIHGLHPDLIKILGRLKFRTSYGQNVLKHSMEVAYLAGLMAAELGEDVK
LARRAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINAIASHHGDTEATSIISSL
VAAADALSAARPGARRETLETYIRRLEKLEEISESFDGVEKTYAIQAGREVRIMVKPDIV
DDVLAHKLARDITKKIEEELDYPGHIRVTVIRETRAVEYAK
Download sequence
Identical sequences Q9KAB2
BSGCAIR31308 BhR157 NYSGXRC-6278c WP_010898531.1.28103 gi|15614941|ref|NP_243244.1| 272558.BH2378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]