SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH2407 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH2407
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-51
Family Ribonuclease PH domain 1-like 0.0000155
Further Details:      
 
Domain Number 2 Region: 290-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-48
Family Ribonuclease PH domain 1-like 0.0000117
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.84e-31
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.64e-27
Family Ribonuclease PH domain 2-like 0.0000891
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 619-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.29e-21
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272558.BH2407
Sequence length 704
Comment (Bacillus halodurans)
Sequence
MEQERHEFSIDWAGRKLTVETGQLAKQANGAVLVRYGDTAVLSTATASKEPKDLPFFPLT
VNYEERLYAAGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFPEGFRNEVQVISIVMSV
DQDCSSEMAAMVGSSLALSISDIPFEGPIAGVTVGRIDGQFVINPTQDQLEKSDIHLVVA
GTKDAINMVEAGAEEVPEDVMLEAIMFGHNEIKRLIEFQEKIAAEVGKSKTDVVLKQVDP
MLEQEVRVKAEEDLKQAVQVPEKHARQDAIEAVMDKVLETYEDNEDVPLSEVNEILHKIV
KEEVRRLITVEKIRPDGREIDEIRPLSSQVGILPRTHGSGLFTRGQTQALSICTLGALGD
VQILDGLGIEESKRFMHHYNFPQFSVGETGPIRGPGRREIGHGALGERALEPVIPSEQDF
PYTIRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLVKQDEHVSVLTDI
QGMEDALGDMDFKVAGTRKGVTALQMDIKISGIDRAILEQALEQARKGRMIILDNMLEAI
SESRSELSPYAPKILTMTINPDKIRDVIGPSGKMINKIIEDTGVKIDIEQDGTIYISSAD
TNMNNKAREIIEDIVREVEVGQMYLGTVKRIEKFGAFVELFKGKDGLVHISQLAEERVNK
VEDVVKIGDEILVKVMEIDNQGRVNLSRKAVLKEQKKAEEQNQK
Download sequence
Identical sequences A0A0M0KIW2 Q9KA83
272558.BH2407 gi|15614970|ref|NP_243273.1| WP_010898560.1.28103 WP_010898560.1.91347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]