SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH2835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH2835
Domain Number 1 Region: 5-213
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-73
Family HD domain 0.00000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH2835
Sequence length 215
Comment (Bacillus halodurans)
Sequence
MNEQAILQSAEAWVKKQLMDEYSGHDWYHIRRVTLMAKAIGEQEKVDVFVVQIAALFHDL
IDDKLVDDPETAKQQLIDWMEAAGVPSQKIDHTMDIINTISFKGGHGQSLATREAMVVQD
ADRLDALGAIGIARTFAYSGNKGQPIYDPELPIRETMTVEEYRHGKSTAINHFYEKLFKL
KDLMNTETGKQLAKERHVFMEQFIERFLSEWNGDM
Download sequence
Identical sequences A0A0M0KIE8 Q9K916
gi|15615398|ref|NP_243701.1| BhR130 WP_010898983.1.28103 WP_010898983.1.91347 272558.BH2835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]