SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272558.BH3236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272558.BH3236
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily CBS-domain pair 7.08e-33
Family CBS-domain pair 0.00038
Further Details:      
 
Domain Number 2 Region: 137-207
Classification Level Classification E-value
Superfamily ACT-like 0.00000000705
Family BT0572-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272558.BH3236
Sequence length 215
Comment (Bacillus halodurans)
Sequence
MLIEEIMKRNVVTIHEQTTIKEAYQTMILEKFRHLPVITKSKDVIGIVTDQDIRDASPSI
FHQDEHQEDLQKPVSSIMTKDVITVHPLNSVAETARLLYENRISCLPVTEGEQLVGIVTD
TDVLHTLVELMGAHQPSSQIYVRVENKAGQLADVAAIMKQRQMNIASVLVYPHREDERYK
ILAFRIQSMDPRGTISDLQSKGYHVLWPNIPGIAT
Download sequence
Identical sequences Q9K7X2
gi|15615798|ref|NP_244102.1| 272558.BH3236 WP_010899378.1.28103 354344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]