SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF0629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272559.BF0629
Domain Number 1 Region: 20-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-39
Family Glycosyl hydrolases family 16 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272559.BF0629
Sequence length 307
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MNTTGRLSFHPSEIPTVFKSPITGRTYHLVFNDEFDDGVIDTLKWDTRSRRSPFTRRGMY
QEKPYYVLCHEDWTKELHGELRLEVSKYPTQNNVVMTGGILSLGRFMARYGYYETKASFR
DCIGEGYWPAFWIHFDEADKYGKGTEIDVFEYIPKDKQIFQTLHWYKKQAMEEQQSEVQH
AALDYDKSGQFKEHRSSTKYFVLDEAQSKEHTFAVEWTPEELIFYTDGKVTRRVNRKDDP
KQVPSAYQMVYFSCSAGEWGGNVMENQVPAYVYFDYCRCYQESDQDAIYTVKGNGMKVPA
SRRVGKL
Download sequence
Identical sequences E1WL93 Q5LHK3
gi|60680191|ref|YP_210335.1| gi|375357035|ref|YP_005109807.1| 272559.BF0629 NYSGXRC-11268b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]