SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF1598 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272559.BF1598
Domain Number 1 Region: 37-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-57
Family Glycosyl hydrolases family 16 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272559.BF1598
Sequence length 274
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MKHKNLLLALPFAFFVFAGISLSSCKDTPVRKLYKSDIDWKLTWQDEFDKDGAPDPEKWV
FSPWHPFCRDNNFVTFVKDGKLVLRALPNNDPNDTIRYMAGCVETLGKKDFLYGRFEVCA
KLGSAKGSWPAIWLKPTDSTTYGAWPKCGEIDIMEQLNKDTFVYHTMHTEYIKVLGHKTD
PDYYTTASYNPHEFNVFGMEWTPDKIDMFINDSLTFSYPRIQEEGSVQWPFDVPFFLLLN
QILGGWAGEIDDTELPVQMEVDWVRYYELPENKK
Download sequence
Identical sequences A0A015TJ98 A0A015U905 A0A015VCR8 A0A015X6D3 A0A015YBD9 A0A015YFI0 A0A015ZTZ6 A0A016CRG1 A0A016CRJ8 A0A016EHA4 A0A016G331 A0A017NDC0 A0A017P1H4 A0A0E2ADW2 A0A0E2ART5 A0A0E2RQ08 A0A0E2SW52 A0A0K6BSH8 D1JKP2 E1WTQ6 I9VWU8 K1FQZ8 Q5LF00
272559.BF1598 gi|60681094|ref|YP_211238.1| gi|375357901|ref|YP_005110673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]