SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF2031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272559.BF2031
Domain Number - Region: 35-57
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.09
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272559.BF2031
Sequence length 99
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MRNSSDEPMIYMVVQSKENSVGNYSTEDGTRTFYTELLHWIKEVLSENLDLMKSLLDNDL
AEEKAKSLVGLDVTNDWSQESIEILFKLVLMYANREPYY
Download sequence
Identical sequences A0A139T978 A0A149NBL3 Q5LDS6
272559.BF2031 WP_010992810.1.22050 WP_010992810.1.37988 WP_010992810.1.58084 WP_010992810.1.6251 WP_010992810.1.95750 WP_010992810.1.97964 gi|60681519|ref|YP_211663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]