SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF2937 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272559.BF2937
Domain Number 1 Region: 58-384
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.23e-36
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 
Weak hits

Sequence:  272559.BF2937
Domain Number - Region: 493-525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0855
Family Clostridium neurotoxins, the second last domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272559.BF2937
Sequence length 567
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MKRLSTLCLLAAGFFIPGQAHQARPTVLDSVYAPLKVATPPSDAYIGLSLLDNGEIRHYN
YGEQAVAGTVYLSSTDHGLTWKRVNRPKEMPFADCQSPVSKEYIRLVDMGAMGVYCIRTS
GGLTGGRTLTKVADRNSIMIKPPVFIRNGKRIVVAAHGGVTPKGCYTYFSDDDGLTWKCS
NTVTSPDHQGGGFHKGIRWNHGAVEPTVVELKDGTLWMLMRTSQDFHYQAFSKDGGQTWG
ESEPSPFYGTITMPTLGRLADGRLLLFWCNTTPLPEKEGTDGVWDDVFTNRDVTHVAVSD
DDGKTWKGFRELYMDPMRNDIDYAVHGGGIDRGVHQAQFVEVAPGKVLASIGQHPLHRAM
MMFDVNWLYEKSRFNDFTDSLSQWSTFNYMNGIKGHCAYNRIQGCMLEPHPRKEGRQVLH
LTYRPDASLVADTRGAVWNFPAMKKGTFTVSLRIPEGSHSVSLLLNDRWMNPSDTVARYQ
SMYELPLTRKQLGVKDDRWHEVSLEWDLLQKRPQARVWVDGRLRPLRLPLKNKSQNGISY
VHFIAPPAEANPGVYLEWVRAEADGAI
Download sequence
Identical sequences A0A139TDG6 A0A149NJB4 Q5LB90
272559.BF2937 WP_010993200.1.37988 WP_010993200.1.42362 WP_010993200.1.58084 WP_010993200.1.6251 WP_010993200.1.95750 gi|60682407|ref|YP_212551.1| BfR215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]