SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF3823 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272559.BF3823
Domain Number - Region: 11-66
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00656
Family CCP-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272559.BF3823
Sequence length 103
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MKLRKLKLNEASKAELNEREMCRVLGGGTIGCCQCGCNYEGKPGGSSTSANDSANNAHGY
TSDGSHPCCSTTDPKPEFPKFPDFPVMPQDALCGATQGHSCGI
Download sequence
Identical sequences A0A015W744 A0A016FUL3 A0A017MZK1 A0A017N6J1 Q5L8T1 Q64NZ0
gi|53715334|ref|YP_101326.1| 272559.BF3823 295405.BF4050 WP_010993587.1.100686 WP_010993587.1.15557 WP_010993587.1.18542 WP_010993587.1.19523 WP_010993587.1.2011 WP_010993587.1.22050 WP_010993587.1.26260 WP_010993587.1.30608 WP_010993587.1.32651 WP_010993587.1.34692 WP_010993587.1.35533 WP_010993587.1.36984 WP_010993587.1.37988 WP_010993587.1.4066 WP_010993587.1.43770 WP_010993587.1.456 WP_010993587.1.46679 WP_010993587.1.5142 WP_010993587.1.51489 WP_010993587.1.53910 WP_010993587.1.58084 WP_010993587.1.65409 WP_010993587.1.65726 WP_010993587.1.65921 WP_010993587.1.66858 WP_010993587.1.66941 WP_010993587.1.73957 WP_010993587.1.75668 WP_010993587.1.76253 WP_010993587.1.81678 WP_010993587.1.87523 WP_010993587.1.88754 WP_010993587.1.91849 WP_010993587.1.95091 WP_010993587.1.97964 YP_101326.1.45732 gi|60683266|ref|YP_213410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]