SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF4060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272559.BF4060
Domain Number 1 Region: 37-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-44
Family Glycosyl hydrolases family 16 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272559.BF4060
Sequence length 286
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MRRILYCFLFIAGGGIIHASAREERVGTEDRIKPDSVLFVDSFDGSSVVPDTAVWKLCTY
ANNAWSQWFRDVNGYENVKVEDGYLKLRACKDNGTYKNGGVFSKIGFPCGTRLEVKARLT
KLVRGGFPAIWQMPIGAPEWPRGGEIDLMEWVQGTPLQIYQTVHTYYINGANGSAGVTNK
NPDKNFDVTKDHVYAVERTEKEVIFYVDGKETWRYGNQYLDEGKLQYPFCEYPFNIILNF
SLGGELNGRMTWSGEICDEDLPGEMWVDWVRVVSLNNENQSDTGDK
Download sequence
Identical sequences A0A016FU11 A0A139SZE9 A0A149MVI2 K1FF53 Q5L859 Q64NE0
gi|60683488|ref|YP_213632.1| WP_005822185.1.18542 WP_005822185.1.21908 WP_005822185.1.26260 WP_005822185.1.31541 WP_005822185.1.35582 WP_005822185.1.37052 WP_005822185.1.37988 WP_005822185.1.38746 WP_005822185.1.48703 WP_005822185.1.50935 WP_005822185.1.51763 WP_005822185.1.58084 WP_005822185.1.6251 WP_005822185.1.91000 WP_005822185.1.95750 WP_005822185.1.98903 YP_101527.1.45732 272559.BF4060 295405.BF4251 gi|53715535|ref|YP_101527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]