SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF4108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272559.BF4108
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-30
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272559.BF4108
Sequence length 216
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MKKVCLSLLMGLMVQMTFGQTLEKMQWFNEPEQWEIKNNVLSMSVTPQSDYWRISHYGFT
VDDAPFYYATYGGEFEAKVKVVGEYKERFDQAGLMLRIDHENYIKAGIEFVDGKFNLSTV
VTHKTSDWSVITLDKTVPYIWIKAVRRLDAVEVFYSFDDKTYTLMRNAWLQDHIPVKVGL
MAACPDGSGFNAKFEYFQVKHLPDQRRVEWLKKNAE
Download sequence
Identical sequences A0A016DD41 A0A139SZE6 A0A149MV53 Q5L815
gi|60683532|ref|YP_213676.1| WP_010993708.1.37988 WP_010993708.1.58084 WP_010993708.1.6251 WP_010993708.1.95750 272559.BF4108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]