SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C0425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272562.CA_C0425
Domain Number 1 Region: 22-337
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.2e-109
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000514
Further Details:      
 
Domain Number 2 Region: 337-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-33
Family Glycosyl hydrolases family 32 C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C0425
Sequence length 490
Comment (Clostridium acetobutylicum)
Sequence
MNSLEFIKKVSYIEEKYRDKVEKDYYRQNYHLMPKVGFMNDPNGLIEINGEYHVFYQYNP
FYPDEKHVCWGHFRSKDLITWECLPVALSPLEWYDSHGCYSGSAVNKGGKLVLMYTGNVK
DSKGERETYQCLAESSDGVEFKKPYINPVIKNQHEGYTRHFRDPKVWKHNDKWYMVLGAQ
REEEKGSTVLYCSDDLQNWSIVHEILGSNLSKFDFLGYMWECPNLFTLDNKDVLLFCPQG
VDKQGDLYNNIYQCGYVLGSLNYETGEFSCGDFLELDRGFEFYAPQVMKTSDGRTLLLGW
MGLPDREVSPTIDNRWLHCLTIIRELKMKDNKVVQKPLRELKRLRKGKVEYKNKIIKDTE
TKLDGINGDSFELKCKFEFDKVNQFGIKMRYNSHKDEEILMFYDAINEKIVFDRSKDGFH
KEADAERKCFIKNNGKVKMHIFMDKSSVEIFINDGEETFTSRIYPSKDSKDIVFYSKGGE
VRLSVDHWQI
Download sequence
Identical sequences Q7D471 Q9L8G4
NP_347065.1.94244 WP_010963747.1.17575 WP_010963747.1.17905 WP_010963747.1.48544 WP_010963747.1.57811 WP_010963747.1.71350 WP_010963747.1.92914 272562.CA_C0425 gi|337735639|ref|YP_004635086.1| gi|384457150|ref|YP_005669570.1| gi|15893716|ref|NP_347065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]