SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C1015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272562.CA_C1015
Domain Number 1 Region: 76-291
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.47e-49
Family Pseudouridine synthase RsuA/RluD 0.00062
Further Details:      
 
Domain Number 2 Region: 11-63
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000306
Family Pseudouridine synthase RsuA N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C1015
Sequence length 318
Comment (Clostridium acetobutylicum)
Sequence
MKIVIGPNEAGQRVDKFIRKWLKDVPLSAIYKAFRKGDVIINGAKCKKEKYSLEEGDVLE
IKYIRSDAKKKKFTRIENNFKVTYEDENMLLVEKWPGVLVHSDKEKTSPTLTDYVLSYLY
DKGDYAPENEVTFTPSPCNRLDRNTSGIVIYGKNFEALKCLNEMIRERRIKKYYYALVKG
KIKDGIYEAYIKKDVSSNKSEIINTPAPGAKQISMEIKCVETCGTFSFIEIELLTGRSHQ
LRAHLSHLGNPILGDPKYGIKDINSYFENKFGLNYQFLYAYKLIFKDCPEKLSYMENKTI
AESLPPIFKKVKRDVFKF
Download sequence
Identical sequences Q97KA4
gi|337736233|ref|YP_004635680.1| NP_347651.1.94244 WP_010964333.1.17575 WP_010964333.1.17905 WP_010964333.1.48544 WP_010964333.1.57811 WP_010964333.1.63117 WP_010964333.1.71350 WP_010964333.1.92914 gi|384457741|ref|YP_005670161.1| 272562.CA_C1015 gi|15894302|ref|NP_347651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]