SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C2298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272562.CA_C2298
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000000236
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.017
Further Details:      
 
Weak hits

Sequence:  272562.CA_C2298
Domain Number - Region: 191-267
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 0.0068
Family C-terminal domain of Ku80 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C2298
Sequence length 298
Comment (Clostridium acetobutylicum)
Sequence
MENDILKYQKAYNTIVKLLKSNEKVLATMVFGSIVSGDLWEESDIDLFVIIDEEMANIKN
IYMEQNDVPIHIKLMGKNKFVLLNENDIKGGFFHRIFASSKLVFSKDKDITEKYDSGRYY
PDIDREKWNMVYISDLLKSLGLCKKYLNNKRIYTAYYFSVKCVEEFSKLYINHSGYMVNK
DDVNMLTNINGDFKNYIDNLFFSKDNVEEAIKEVVDKIEEFINKNIKSITAILIDYMRDK
DKSLSAEDINTDPVFNDFSINFEEILSKLWEFNIIKKGTRKYSIKDGKALCMENVYYL
Download sequence
Identical sequences Q97GR8
375879 272562.CA_C2298 NP_348914.1.94244 WP_010965595.1.17575 WP_010965595.1.17905 WP_010965595.1.48544 WP_010965595.1.57811 WP_010965595.1.71350 WP_010965595.1.92914 gi|337737515|ref|YP_004636962.1| gi|384459025|ref|YP_005671445.1| gi|15895565|ref|NP_348914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]