SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C3436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272562.CA_C3436
Domain Number 1 Region: 205-545
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.02e-69
Family beta-glycanases 0.00042
Further Details:      
 
Domain Number 2 Region: 613-733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000792
Family Alginate lyase 0.069
Further Details:      
 
Domain Number 3 Region: 73-223
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000113
Family CBM4/9 0.06
Further Details:      
 
Domain Number 4 Region: 732-833
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000342
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C3436
Sequence length 835
Comment (Clostridium acetobutylicum)
Sequence
MKKRYLTILMSTFLTTGAVLSYTSLSAKAAPTTNDDYTLNINTDNKLFNESDMLTGLFFE
DINHGADGGLYSELLQNQSFEFKDSLSSWTVDKTGSTSSTAEVCTSKPLNSNNTHYLELN
CPDNNSSLKLVNSGYKGITVNNNAKYDFYFWARNVGKGNKVTIQLEDENGNAISEDKTIG
KINGQWRKYEGHLRATKSTSNAKLAVSITGEAKMNLDMVSLFPQDTWKNRKYGLRKDLVE
RLKDLKPRFLRFPGGCIVEGNSKEEIYNWKDTIGNVEERKENTNLWGYNQSYGLGFYEYF
QLCEDIGATPVPVLNCGMTCQARGVNGVPNYMAPVGPDLDPYIQNAVDLVEYANGDASTY
WGRKRIESGHKKPFNLKYMAIGNEQWGPEYHKRFEAFQKVLNQKCPGITLISNAGTSPSG
STFDDNWNWIKEKAPNTVVDEHYYMSPDWFLSNTNRYDKYDRNSNKVFVGEYASQSNTLK
SALAEGAYLTGLERNSDIVKMASYAPLFAKADDYQWSPDMIWFNGNTNYVTPNYNVQKLF
STNLGTQIVKGDLIKPTAHVKNDIKGGVLLGAWSTQVQYDNVKVTDNTTGKEIFSDSFDN
NINQWTSASGNWVVKDGKLELDQIADNCRILTKDNTWSNYTLSVDAKKLSGKEGFLVGFG
AKDSSNFYWYNIGGWGNTKTAVEKETDGSKSTVSEADAKYSTVTTGQDYKIKIVVDGNKV
SCYLNGQLTNQFTAPERDTDVYTSTSYDSKTNELIAKVVNVADEDRKVRINVNGSKNISS
TANVQYITGSSEDDTNSFDKPENVSIKTKKLNNISKNFDYDADKYSVSVIRIKLK
Download sequence
Identical sequences Q97DN6
NP_350026.1.94244 272562.CA_C3436 gi|15896677|ref|NP_350026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]