SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272562.CA_P0114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272562.CA_P0114
Domain Number 1 Region: 42-320
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.18e-53
Family alpha-L-arabinanase-like 0.00015
Further Details:      
 
Domain Number 2 Region: 343-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-40
Family Beta-D-xylosidase C-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_P0114
Sequence length 531
Comment (Clostridium acetobutylicum)
Sequence
MLKKRKFSFKKLGCIAVLICMAVAAKSFLAKAYTSDLGNGTYQNPVMYADYPDNSVIKVG
STYYMACSSINYMPGLPILKSQDLVNWEICSYAFDRIDTGMSGIDKTHADAYNLVGGENV
YSKGCWAPSLKYHNGTFYATFASLDLGKTFVCTKTGPMGFGGWTFTAISGIGYAHDADLF
FDTDGRVYLINGGCNVTELTPDCKSVKYGGINQKIFDGGPSHDGNRIFKKNGYYYILSTP
IKGNGAYQRIEKAWRSKSLTGPYEQTIILDDGANHQVCVVDDGSYNWAMLFEDKGAVGRI
PKLAPVTWVNNWPMIGVNGSATVPNIYNKPAAGNGIKSPGTDDDFTSQGYVLSQWQWNHN
PDNSKWTTSERPGWMRLKTSYSKDFLQARNTLTQRIQGPASSGWVKLDTTNIKPGQISGL
SAFHSKYGYIGVRNDNGTKKLVQYNVTGSETAINLTNNIVYLKVSTDCNAQTAKFYYSYN
GNSWTQLGSTLKMDFFYKLWFVGYRFALFNYTTGSDTSGYADFDYFKFSSF
Download sequence
Identical sequences Q97TI7
272562.CA_P0114 gi|384456654|ref|YP_005672991.1| gi|337735144|ref|YP_004634592.1| gi|15004817|ref|NP_149277.1| NP_149277.1.94244 WP_010890798.1.17575 WP_010890798.1.17905 WP_010890798.1.48544 WP_010890798.1.57811 WP_010890798.1.71350 WP_010890798.1.92914 gi|15004817|ref|NP_149277.1|NC_001988 gi|337735144|ref|YP_004634592.1|NC_015686 gi|384456654|ref|YP_005672991.1|NC_017296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]