SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272563.CD1318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272563.CD1318
Domain Number 1 Region: 296-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-49
Family Ribonuclease PH domain 1-like 0.00000823
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.02e-46
Family Ribonuclease PH domain 1-like 0.0000153
Further Details:      
 
Domain Number 3 Region: 455-562
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.59e-27
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 4 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-27
Family Ribonuclease PH domain 2-like 0.0025
Further Details:      
 
Domain Number 5 Region: 610-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-22
Family Cold shock DNA-binding domain-like 0.00037
Further Details:      
 
Domain Number 6 Region: 240-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000191
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0047
Further Details:      
 
Domain Number 7 Region: 557-624
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000653
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272563.CD1318
Sequence length 703
Comment (Clostridium difficile 630)
Sequence
MFEHKIFKMDFAGRELSVEIGKICEMASGSCIVRYSDSMVMVNTTKSAKPRDGIDFFPLS
VDYEEKLYSVGKIPGGFLKREGKPSEKAILTSRLIDRPIRPLFPKGFRNDVQVVATVLSV
DQDCTPDIVAMIGSSIALSISDIPFNGPTGSVCVGLVDGAFVVNPNAEQREKSSMHLVVS
GTKEAIMMVEAGADEVPDEVMLDAILFAHQEIKKIVEFIEGIVAEVGKEKMPVELYHAGE
EITQLVREFATDKMKKAVQTFEKLERMENMDRVKEETLAHFEETLEDFEDFVGDIEEVLQ
DIIKEEVRKLIVHENVRPDNRKLEEIRPIWCETGMIPRAHGSAIFTRGQTQVLNVATLGA
LGDVQKLDGLDEEENKRYMHHYNFPAYSVGEARPSRGPGRREIGHGALAERALLPVIPSQ
EEFPYAIRLVSEVLSSNGSTSQASVCGSTLSLLDAGVPIKDMVAGIAMGLIKHDGKVAVL
SDIQGMEDHLGDMDFKVAGTEYGITAIQMDIKIDGIDKEILQRALKQAKEGRIHILGEMR
KTISQPKPELSPYAPKIVKMQINPDKIKDVIGPGGKIITKIIDETGVKIDIEQTGEVFIS
GIEIDMIKKAQELINNIVVEPEVGKTYKGKVSRIMNFGAFVEILPGKEGLLHISHIAHER
VAKVEDVLNIGDEVEVKVTEIDEKGRVNLSRKVLLPKPEHKNK
Download sequence
Identical sequences A0A031WFI5 A0A0H3N181 A0A125V4M9 A0A1F2CTL5 C9YKQ7 Q18BI4 T4HXD5
gi|126698917|ref|YP_001087814.1| gi|260682926|ref|YP_003214211.1| 272563.CD1318 645462.CD196_1181 645463.CDR20291_1159 WP_003438316.1.100055 WP_003438316.1.100097 WP_003438316.1.100107 WP_003438316.1.100118 WP_003438316.1.100139 WP_003438316.1.100513 WP_003438316.1.100570 WP_003438316.1.100660 WP_003438316.1.100977 WP_003438316.1.101035 WP_003438316.1.101125 WP_003438316.1.101279 WP_003438316.1.10130 WP_003438316.1.101316 WP_003438316.1.101532 WP_003438316.1.101861 WP_003438316.1.102031 WP_003438316.1.102074 WP_003438316.1.102095 WP_003438316.1.10483 WP_003438316.1.10488 WP_003438316.1.10582 WP_003438316.1.10691 WP_003438316.1.10793 WP_003438316.1.10795 WP_003438316.1.11025 WP_003438316.1.11224 WP_003438316.1.11320 WP_003438316.1.11398 WP_003438316.1.1167 WP_003438316.1.1179 WP_003438316.1.11937 WP_003438316.1.11959 WP_003438316.1.12066 WP_003438316.1.12169 WP_003438316.1.1254 WP_003438316.1.12659 WP_003438316.1.1273 WP_003438316.1.12807 WP_003438316.1.12809 WP_003438316.1.13040 WP_003438316.1.13251 WP_003438316.1.13273 WP_003438316.1.13398 WP_003438316.1.13418 WP_003438316.1.13730 WP_003438316.1.13841 WP_003438316.1.13859 WP_003438316.1.14045 WP_003438316.1.14170 WP_003438316.1.14177 WP_003438316.1.14205 WP_003438316.1.1422 WP_003438316.1.14259 WP_003438316.1.14330 WP_003438316.1.14352 WP_003438316.1.1445 WP_003438316.1.14457 WP_003438316.1.14483 WP_003438316.1.14579 WP_003438316.1.14674 WP_003438316.1.14686 WP_003438316.1.14698 WP_003438316.1.1494 WP_003438316.1.15083 WP_003438316.1.15097 WP_003438316.1.15192 WP_003438316.1.15205 WP_003438316.1.15310 WP_003438316.1.15435 WP_003438316.1.15908 WP_003438316.1.16012 WP_003438316.1.16135 WP_003438316.1.16185 WP_003438316.1.16190 WP_003438316.1.16376 WP_003438316.1.16520 WP_003438316.1.16728 WP_003438316.1.169 WP_003438316.1.16931 WP_003438316.1.16966 WP_003438316.1.1705 WP_003438316.1.17413 WP_003438316.1.17463 WP_003438316.1.17512 WP_003438316.1.17611 WP_003438316.1.17638 WP_003438316.1.17808 WP_003438316.1.17851 WP_003438316.1.17879 WP_003438316.1.17908 WP_003438316.1.17960 WP_003438316.1.18060 WP_003438316.1.18212 WP_003438316.1.18298 WP_003438316.1.1838 WP_003438316.1.18407 WP_003438316.1.18455 WP_003438316.1.18462 WP_003438316.1.18551 WP_003438316.1.18680 WP_003438316.1.18805 WP_003438316.1.18970 WP_003438316.1.19088 WP_003438316.1.19152 WP_003438316.1.1926 WP_003438316.1.1934 WP_003438316.1.19627 WP_003438316.1.19704 WP_003438316.1.19899 WP_003438316.1.19956 WP_003438316.1.1999 WP_003438316.1.2002 WP_003438316.1.20132 WP_003438316.1.20184 WP_003438316.1.20302 WP_003438316.1.20313 WP_003438316.1.20481 WP_003438316.1.20650 WP_003438316.1.20728 WP_003438316.1.20872 WP_003438316.1.20875 WP_003438316.1.20960 WP_003438316.1.21000 WP_003438316.1.21048 WP_003438316.1.21201 WP_003438316.1.21220 WP_003438316.1.21417 WP_003438316.1.21520 WP_003438316.1.21547 WP_003438316.1.21618 WP_003438316.1.21704 WP_003438316.1.21893 WP_003438316.1.22020 WP_003438316.1.22079 WP_003438316.1.22222 WP_003438316.1.22228 WP_003438316.1.22313 WP_003438316.1.22411 WP_003438316.1.22417 WP_003438316.1.22568 WP_003438316.1.22569 WP_003438316.1.22615 WP_003438316.1.22768 WP_003438316.1.22893 WP_003438316.1.22937 WP_003438316.1.23096 WP_003438316.1.23208 WP_003438316.1.23287 WP_003438316.1.23338 WP_003438316.1.2363 WP_003438316.1.24197 WP_003438316.1.24457 WP_003438316.1.24889 WP_003438316.1.24900 WP_003438316.1.24987 WP_003438316.1.25128 WP_003438316.1.25416 WP_003438316.1.25761 WP_003438316.1.26024 WP_003438316.1.26482 WP_003438316.1.26494 WP_003438316.1.26697 WP_003438316.1.26829 WP_003438316.1.26940 WP_003438316.1.27563 WP_003438316.1.27677 WP_003438316.1.27708 WP_003438316.1.27824 WP_003438316.1.27872 WP_003438316.1.27881 WP_003438316.1.27890 WP_003438316.1.27989 WP_003438316.1.27996 WP_003438316.1.28055 WP_003438316.1.28410 WP_003438316.1.28638 WP_003438316.1.28715 WP_003438316.1.28856 WP_003438316.1.28890 WP_003438316.1.2923 WP_003438316.1.293 WP_003438316.1.29600 WP_003438316.1.29757 WP_003438316.1.2982 WP_003438316.1.29891 WP_003438316.1.303 WP_003438316.1.3031 WP_003438316.1.30420 WP_003438316.1.30431 WP_003438316.1.30463 WP_003438316.1.30519 WP_003438316.1.30521 WP_003438316.1.30743 WP_003438316.1.30841 WP_003438316.1.30953 WP_003438316.1.31160 WP_003438316.1.31183 WP_003438316.1.31203 WP_003438316.1.31292 WP_003438316.1.31309 WP_003438316.1.31351 WP_003438316.1.31385 WP_003438316.1.31453 WP_003438316.1.31475 WP_003438316.1.31477 WP_003438316.1.31519 WP_003438316.1.31637 WP_003438316.1.31719 WP_003438316.1.31742 WP_003438316.1.31960 WP_003438316.1.31969 WP_003438316.1.32008 WP_003438316.1.32066 WP_003438316.1.32119 WP_003438316.1.32197 WP_003438316.1.32218 WP_003438316.1.32230 WP_003438316.1.32294 WP_003438316.1.32699 WP_003438316.1.32776 WP_003438316.1.32842 WP_003438316.1.33056 WP_003438316.1.33098 WP_003438316.1.33164 WP_003438316.1.33298 WP_003438316.1.33349 WP_003438316.1.3340 WP_003438316.1.33514 WP_003438316.1.33810 WP_003438316.1.34388 WP_003438316.1.34489 WP_003438316.1.34641 WP_003438316.1.34800 WP_003438316.1.34985 WP_003438316.1.35 WP_003438316.1.35002 WP_003438316.1.35137 WP_003438316.1.35181 WP_003438316.1.35187 WP_003438316.1.35234 WP_003438316.1.3559 WP_003438316.1.35709 WP_003438316.1.35832 WP_003438316.1.35884 WP_003438316.1.36078 WP_003438316.1.36338 WP_003438316.1.36738 WP_003438316.1.36835 WP_003438316.1.37255 WP_003438316.1.374 WP_003438316.1.37493 WP_003438316.1.37532 WP_003438316.1.37597 WP_003438316.1.37861 WP_003438316.1.3789 WP_003438316.1.37981 WP_003438316.1.38305 WP_003438316.1.38338 WP_003438316.1.38692 WP_003438316.1.38775 WP_003438316.1.38814 WP_003438316.1.38874 WP_003438316.1.38924 WP_003438316.1.38986 WP_003438316.1.39008 WP_003438316.1.3913 WP_003438316.1.39213 WP_003438316.1.39350 WP_003438316.1.39382 WP_003438316.1.39442 WP_003438316.1.39525 WP_003438316.1.39621 WP_003438316.1.39783 WP_003438316.1.39874 WP_003438316.1.39876 WP_003438316.1.39975 WP_003438316.1.39981 WP_003438316.1.40030 WP_003438316.1.40294 WP_003438316.1.40313 WP_003438316.1.40447 WP_003438316.1.40522 WP_003438316.1.40557 WP_003438316.1.407 WP_003438316.1.40775 WP_003438316.1.40891 WP_003438316.1.40959 WP_003438316.1.40966 WP_003438316.1.41131 WP_003438316.1.4121 WP_003438316.1.41334 WP_003438316.1.41342 WP_003438316.1.4137 WP_003438316.1.41506 WP_003438316.1.41534 WP_003438316.1.41641 WP_003438316.1.41687 WP_003438316.1.41818 WP_003438316.1.41995 WP_003438316.1.42035 WP_003438316.1.4204 WP_003438316.1.42066 WP_003438316.1.42532 WP_003438316.1.42533 WP_003438316.1.42610 WP_003438316.1.42664 WP_003438316.1.43112 WP_003438316.1.4321 WP_003438316.1.43388 WP_003438316.1.43490 WP_003438316.1.43519 WP_003438316.1.43579 WP_003438316.1.43663 WP_003438316.1.43824 WP_003438316.1.4383 WP_003438316.1.44030 WP_003438316.1.44105 WP_003438316.1.44149 WP_003438316.1.44198 WP_003438316.1.44241 WP_003438316.1.44470 WP_003438316.1.44471 WP_003438316.1.44729 WP_003438316.1.45017 WP_003438316.1.45059 WP_003438316.1.45142 WP_003438316.1.45165 WP_003438316.1.45209 WP_003438316.1.45257 WP_003438316.1.45352 WP_003438316.1.45554 WP_003438316.1.4573 WP_003438316.1.45986 WP_003438316.1.46274 WP_003438316.1.46280 WP_003438316.1.46305 WP_003438316.1.46522 WP_003438316.1.4698 WP_003438316.1.47016 WP_003438316.1.47227 WP_003438316.1.47228 WP_003438316.1.47479 WP_003438316.1.47615 WP_003438316.1.47708 WP_003438316.1.47729 WP_003438316.1.47940 WP_003438316.1.48220 WP_003438316.1.48246 WP_003438316.1.48279 WP_003438316.1.4835 WP_003438316.1.48733 WP_003438316.1.48746 WP_003438316.1.48772 WP_003438316.1.48935 WP_003438316.1.48980 WP_003438316.1.48983 WP_003438316.1.48991 WP_003438316.1.49020 WP_003438316.1.49054 WP_003438316.1.49065 WP_003438316.1.4908 WP_003438316.1.49092 WP_003438316.1.49230 WP_003438316.1.49310 WP_003438316.1.49339 WP_003438316.1.4948 WP_003438316.1.49633 WP_003438316.1.50159 WP_003438316.1.50341 WP_003438316.1.50865 WP_003438316.1.51007 WP_003438316.1.51235 WP_003438316.1.51675 WP_003438316.1.51996 WP_003438316.1.52266 WP_003438316.1.52278 WP_003438316.1.52311 WP_003438316.1.52383 WP_003438316.1.52402 WP_003438316.1.52466 WP_003438316.1.52525 WP_003438316.1.52789 WP_003438316.1.52958 WP_003438316.1.52997 WP_003438316.1.53008 WP_003438316.1.53044 WP_003438316.1.53055 WP_003438316.1.5337 WP_003438316.1.53504 WP_003438316.1.53710 WP_003438316.1.53729 WP_003438316.1.53987 WP_003438316.1.54058 WP_003438316.1.54153 WP_003438316.1.54262 WP_003438316.1.54350 WP_003438316.1.54586 WP_003438316.1.54692 WP_003438316.1.55055 WP_003438316.1.55101 WP_003438316.1.5521 WP_003438316.1.55302 WP_003438316.1.55371 WP_003438316.1.55391 WP_003438316.1.5558 WP_003438316.1.56006 WP_003438316.1.56217 WP_003438316.1.56252 WP_003438316.1.56323 WP_003438316.1.56337 WP_003438316.1.56556 WP_003438316.1.5657 WP_003438316.1.5661 WP_003438316.1.5664 WP_003438316.1.56664 WP_003438316.1.56711 WP_003438316.1.56754 WP_003438316.1.56927 WP_003438316.1.56998 WP_003438316.1.57337 WP_003438316.1.57711 WP_003438316.1.57827 WP_003438316.1.58015 WP_003438316.1.58216 WP_003438316.1.58304 WP_003438316.1.58315 WP_003438316.1.58323 WP_003438316.1.58463 WP_003438316.1.58531 WP_003438316.1.58665 WP_003438316.1.58677 WP_003438316.1.58711 WP_003438316.1.58818 WP_003438316.1.58956 WP_003438316.1.5905 WP_003438316.1.59588 WP_003438316.1.59618 WP_003438316.1.59628 WP_003438316.1.59707 WP_003438316.1.59752 WP_003438316.1.59990 WP_003438316.1.60482 WP_003438316.1.60563 WP_003438316.1.6070 WP_003438316.1.60998 WP_003438316.1.61042 WP_003438316.1.61140 WP_003438316.1.61293 WP_003438316.1.61492 WP_003438316.1.61679 WP_003438316.1.61716 WP_003438316.1.61866 WP_003438316.1.61972 WP_003438316.1.62049 WP_003438316.1.62095 WP_003438316.1.62128 WP_003438316.1.62340 WP_003438316.1.62577 WP_003438316.1.62624 WP_003438316.1.62637 WP_003438316.1.62941 WP_003438316.1.62986 WP_003438316.1.63020 WP_003438316.1.63059 WP_003438316.1.63239 WP_003438316.1.63248 WP_003438316.1.63343 WP_003438316.1.63378 WP_003438316.1.63516 WP_003438316.1.63570 WP_003438316.1.63581 WP_003438316.1.63598 WP_003438316.1.63599 WP_003438316.1.63696 WP_003438316.1.63853 WP_003438316.1.63950 WP_003438316.1.64092 WP_003438316.1.64197 WP_003438316.1.64369 WP_003438316.1.64447 WP_003438316.1.64546 WP_003438316.1.64573 WP_003438316.1.65064 WP_003438316.1.65067 WP_003438316.1.65313 WP_003438316.1.65369 WP_003438316.1.65889 WP_003438316.1.66084 WP_003438316.1.66119 WP_003438316.1.66237 WP_003438316.1.66439 WP_003438316.1.66474 WP_003438316.1.66565 WP_003438316.1.66587 WP_003438316.1.66608 WP_003438316.1.66643 WP_003438316.1.66701 WP_003438316.1.6671 WP_003438316.1.6675 WP_003438316.1.66847 WP_003438316.1.6685 WP_003438316.1.66887 WP_003438316.1.66888 WP_003438316.1.66900 WP_003438316.1.670 WP_003438316.1.67303 WP_003438316.1.67308 WP_003438316.1.67528 WP_003438316.1.67689 WP_003438316.1.67695 WP_003438316.1.67711 WP_003438316.1.6792 WP_003438316.1.67951 WP_003438316.1.68150 WP_003438316.1.68322 WP_003438316.1.68955 WP_003438316.1.6898 WP_003438316.1.68980 WP_003438316.1.69114 WP_003438316.1.692 WP_003438316.1.69220 WP_003438316.1.69495 WP_003438316.1.69708 WP_003438316.1.6994 WP_003438316.1.700 WP_003438316.1.70152 WP_003438316.1.70231 WP_003438316.1.70320 WP_003438316.1.70695 WP_003438316.1.70710 WP_003438316.1.70820 WP_003438316.1.70886 WP_003438316.1.71079 WP_003438316.1.71119 WP_003438316.1.713 WP_003438316.1.71384 WP_003438316.1.71477 WP_003438316.1.7156 WP_003438316.1.71745 WP_003438316.1.7199 WP_003438316.1.72113 WP_003438316.1.72245 WP_003438316.1.72468 WP_003438316.1.72483 WP_003438316.1.72560 WP_003438316.1.72682 WP_003438316.1.72891 WP_003438316.1.72909 WP_003438316.1.72914 WP_003438316.1.72994 WP_003438316.1.73026 WP_003438316.1.73116 WP_003438316.1.7322 WP_003438316.1.73836 WP_003438316.1.73931 WP_003438316.1.74116 WP_003438316.1.74126 WP_003438316.1.74672 WP_003438316.1.74678 WP_003438316.1.74680 WP_003438316.1.74779 WP_003438316.1.74835 WP_003438316.1.74897 WP_003438316.1.75026 WP_003438316.1.751 WP_003438316.1.75210 WP_003438316.1.75226 WP_003438316.1.75287 WP_003438316.1.75454 WP_003438316.1.75659 WP_003438316.1.76207 WP_003438316.1.7650 WP_003438316.1.76550 WP_003438316.1.76552 WP_003438316.1.76603 WP_003438316.1.76621 WP_003438316.1.76664 WP_003438316.1.76687 WP_003438316.1.76793 WP_003438316.1.76882 WP_003438316.1.76924 WP_003438316.1.7696 WP_003438316.1.77092 WP_003438316.1.77102 WP_003438316.1.77473 WP_003438316.1.77509 WP_003438316.1.77544 WP_003438316.1.7755 WP_003438316.1.77639 WP_003438316.1.77782 WP_003438316.1.77842 WP_003438316.1.77942 WP_003438316.1.78123 WP_003438316.1.78579 WP_003438316.1.7916 WP_003438316.1.79199 WP_003438316.1.79221 WP_003438316.1.79309 WP_003438316.1.79344 WP_003438316.1.79611 WP_003438316.1.79680 WP_003438316.1.79703 WP_003438316.1.79836 WP_003438316.1.80052 WP_003438316.1.80144 WP_003438316.1.80342 WP_003438316.1.80379 WP_003438316.1.80455 WP_003438316.1.80504 WP_003438316.1.80575 WP_003438316.1.80963 WP_003438316.1.81035 WP_003438316.1.81044 WP_003438316.1.81208 WP_003438316.1.81299 WP_003438316.1.81351 WP_003438316.1.81402 WP_003438316.1.81605 WP_003438316.1.81777 WP_003438316.1.82084 WP_003438316.1.82335 WP_003438316.1.82635 WP_003438316.1.82701 WP_003438316.1.8314 WP_003438316.1.83148 WP_003438316.1.83255 WP_003438316.1.83287 WP_003438316.1.83318 WP_003438316.1.83348 WP_003438316.1.8336 WP_003438316.1.834 WP_003438316.1.83515 WP_003438316.1.83822 WP_003438316.1.83918 WP_003438316.1.84253 WP_003438316.1.84528 WP_003438316.1.84646 WP_003438316.1.84843 WP_003438316.1.84880 WP_003438316.1.84923 WP_003438316.1.85020 WP_003438316.1.85127 WP_003438316.1.85219 WP_003438316.1.8527 WP_003438316.1.85420 WP_003438316.1.85442 WP_003438316.1.85454 WP_003438316.1.85776 WP_003438316.1.85863 WP_003438316.1.8587 WP_003438316.1.85874 WP_003438316.1.85932 WP_003438316.1.86008 WP_003438316.1.86011 WP_003438316.1.86049 WP_003438316.1.86088 WP_003438316.1.86094 WP_003438316.1.86117 WP_003438316.1.86328 WP_003438316.1.86395 WP_003438316.1.86534 WP_003438316.1.86743 WP_003438316.1.86767 WP_003438316.1.86837 WP_003438316.1.86914 WP_003438316.1.87058 WP_003438316.1.87195 WP_003438316.1.87326 WP_003438316.1.87454 WP_003438316.1.87714 WP_003438316.1.87723 WP_003438316.1.87730 WP_003438316.1.87918 WP_003438316.1.87932 WP_003438316.1.88091 WP_003438316.1.882 WP_003438316.1.88268 WP_003438316.1.88332 WP_003438316.1.88364 WP_003438316.1.88372 WP_003438316.1.88377 WP_003438316.1.88608 WP_003438316.1.88640 WP_003438316.1.88996 WP_003438316.1.89052 WP_003438316.1.89065 WP_003438316.1.89196 WP_003438316.1.89337 WP_003438316.1.89364 WP_003438316.1.89457 WP_003438316.1.89629 WP_003438316.1.89697 WP_003438316.1.8984 WP_003438316.1.89994 WP_003438316.1.90076 WP_003438316.1.90101 WP_003438316.1.90164 WP_003438316.1.90329 WP_003438316.1.9041 WP_003438316.1.90491 WP_003438316.1.90555 WP_003438316.1.90643 WP_003438316.1.9083 WP_003438316.1.90938 WP_003438316.1.90981 WP_003438316.1.90985 WP_003438316.1.91065 WP_003438316.1.91254 WP_003438316.1.91314 WP_003438316.1.91406 WP_003438316.1.91570 WP_003438316.1.91648 WP_003438316.1.92075 WP_003438316.1.92284 WP_003438316.1.92371 WP_003438316.1.92576 WP_003438316.1.92658 WP_003438316.1.92697 WP_003438316.1.92941 WP_003438316.1.93171 WP_003438316.1.93313 WP_003438316.1.93360 WP_003438316.1.93480 WP_003438316.1.93615 WP_003438316.1.93687 WP_003438316.1.93717 WP_003438316.1.93766 WP_003438316.1.93782 WP_003438316.1.93798 WP_003438316.1.93802 WP_003438316.1.93830 WP_003438316.1.9393 WP_003438316.1.93968 WP_003438316.1.94067 WP_003438316.1.94073 WP_003438316.1.94166 WP_003438316.1.94427 WP_003438316.1.94768 WP_003438316.1.94968 WP_003438316.1.95095 WP_003438316.1.95173 WP_003438316.1.9522 WP_003438316.1.95350 WP_003438316.1.95517 WP_003438316.1.9580 WP_003438316.1.95847 WP_003438316.1.95893 WP_003438316.1.96113 WP_003438316.1.9635 WP_003438316.1.96503 WP_003438316.1.96505 WP_003438316.1.9666 WP_003438316.1.96690 WP_003438316.1.96765 WP_003438316.1.97219 WP_003438316.1.97458 WP_003438316.1.97682 WP_003438316.1.97806 WP_003438316.1.98037 WP_003438316.1.98622 WP_003438316.1.98715 WP_003438316.1.98748 WP_003438316.1.98856 WP_003438316.1.98997 WP_003438316.1.99064 WP_003438316.1.99134 WP_003438316.1.99333 WP_003438316.1.99542 WP_003438316.1.99731 WP_003438316.1.9986 YP_001087814.1.32744 gi|384360513|ref|YP_006198365.1| gi|260686524|ref|YP_003217657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]