SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272563.CD1805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272563.CD1805
Domain Number 1 Region: 25-338
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.57e-103
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000399
Further Details:      
 
Domain Number 2 Region: 337-476
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-26
Family Glycosyl hydrolases family 32 C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272563.CD1805
Sequence length 493
Comment (Clostridium difficile 630)
Sequence
MYKEPKYRTILESTKEELNKLRNISLNDKYKPLFHIHPQHGLLNDPNGLAYYNGKYHVFY
QWYPYDATHGMKHWAYVSSDDFVNWNREDVALIPIESYESHGAYSGNAIEVDGKLHMYYT
GNIKYSAEDRYAYQNLAIMNKDGKITKYENNPIVSEIPKGYTGHVRDPKVFKRKDKYFML
LGAQTSDKKGVIIVYESKNSIDWNFKGELNVKNIDEDFGYMWECPDYINIDEKDILIFSP
QGVEPKGFDYQNIYNVVYAIGNMDLDNLTFEIDTMKELEKGFDFYAPQTFIKDSQIILFA
WAGMGEVLYPTDKNKWAHCLTVPRKLNIKNNKLLQMPVDELIKLRYDETSGQNTIKNNIN
IIENNENLYELNINIKNIDSNKFGLELFSSQDEGVKLEFNKLGNIVTLDRSNFKKVFGVE
YGTNRKEYINIDENTNIKVLADRSILEIFINDGEVVFTSRIFAKENSNQIRVYSDKIVEY
EYTKFKLKQGIEL
Download sequence
Identical sequences A0A125V682 A0A2J9P2E4 Q187B5
gi|126699414|ref|YP_001088311.1| WP_009896953.1.100660 WP_009896953.1.101532 WP_009896953.1.11224 WP_009896953.1.1422 WP_009896953.1.14330 WP_009896953.1.15192 WP_009896953.1.16012 WP_009896953.1.16135 WP_009896953.1.19704 WP_009896953.1.20481 WP_009896953.1.20728 WP_009896953.1.24197 WP_009896953.1.24457 WP_009896953.1.24900 WP_009896953.1.25761 WP_009896953.1.26697 WP_009896953.1.32197 WP_009896953.1.32294 WP_009896953.1.33098 WP_009896953.1.34489 WP_009896953.1.35884 WP_009896953.1.37597 WP_009896953.1.39213 WP_009896953.1.41131 WP_009896953.1.4137 WP_009896953.1.4321 WP_009896953.1.47708 WP_009896953.1.47940 WP_009896953.1.48991 WP_009896953.1.49310 WP_009896953.1.50341 WP_009896953.1.56252 WP_009896953.1.56337 WP_009896953.1.5664 WP_009896953.1.58304 WP_009896953.1.58315 WP_009896953.1.58463 WP_009896953.1.58818 WP_009896953.1.5905 WP_009896953.1.59618 WP_009896953.1.6070 WP_009896953.1.61866 WP_009896953.1.62049 WP_009896953.1.62095 WP_009896953.1.62624 WP_009896953.1.64573 WP_009896953.1.66887 WP_009896953.1.67711 WP_009896953.1.68150 WP_009896953.1.69114 WP_009896953.1.70695 WP_009896953.1.70710 WP_009896953.1.71477 WP_009896953.1.74672 WP_009896953.1.75210 WP_009896953.1.75226 WP_009896953.1.75638 WP_009896953.1.75659 WP_009896953.1.76882 WP_009896953.1.77092 WP_009896953.1.77509 WP_009896953.1.78123 WP_009896953.1.78579 WP_009896953.1.79344 WP_009896953.1.79437 WP_009896953.1.79703 WP_009896953.1.81044 WP_009896953.1.81402 WP_009896953.1.8314 WP_009896953.1.83255 WP_009896953.1.85127 WP_009896953.1.85420 WP_009896953.1.8587 WP_009896953.1.86767 WP_009896953.1.87326 WP_009896953.1.92075 WP_009896953.1.92371 WP_009896953.1.93782 WP_009896953.1.93802 WP_009896953.1.94166 WP_009896953.1.94427 WP_009896953.1.95095 WP_009896953.1.96505 WP_009896953.1.98856 YP_001088311.1.32744 272563.CD1805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]