SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272564.Dhaf_0687 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272564.Dhaf_0687
Domain Number 1 Region: 21-136
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-20
Family cAMP-binding domain 0.00052
Further Details:      
 
Domain Number 2 Region: 147-222
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.95e-16
Family CAP C-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272564.Dhaf_0687
Sequence length 228
Comment (Desulfitobacterium hafniense DCB 2)
Sequence
MGEILKNYIFPDTFYPVPKFKDYIYLGSQRSYCKGETVLLPDEVLGRIIFVLSGKLNVSK
ITEDGREKFVYSAGQFCFMDRLFTFENDHMQIVAIEDSKVCLFSKEQLLAAFKQDEELII
DVLRHYDSKVYYFMNLNSEINLYSPSVRLLRLFYELSHSKGEYDKGVWKVEIELTNKKIS
EITGLHYVTVSKILGSLKKAGILKKRKSKIIIYDLEKLKALLEEGIAY
Download sequence
Identical sequences B8FVW5 Q8RPI2
272564.Dhaf_0687 WP_015942947.1.13927 WP_015942947.1.82035 gi|219666752|ref|YP_002457187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]