SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272564.Dhaf_1724 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272564.Dhaf_1724
Domain Number 1 Region: 29-150
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-29
Family cAMP-binding domain 0.0058
Further Details:      
 
Domain Number 2 Region: 155-228
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000247
Family CAP C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272564.Dhaf_1724
Sequence length 230
Comment (Desulfitobacterium hafniense DCB 2)
Sequence
MNDGSNDFELLGSPWICENPHANWTAPAAHGMFKRFKKKEIIIHSGDQIDYIYYLHKGRI
KTVAQSPSGSQKILWYIEAGSIFGETPFFNRKPCDYNFFAVTDCEIYIYPMEVIMQEIIP
KFPDLTLSIIKTLSRKVHILSTQVEDCVFNKPLVRVAKLIYLLHQGRILEDKRGSSSIPL
TQEDIANTLGMHRVTVNQALKHLKEIQALKEHTHLIIIHDPEKLKEVMEA
Download sequence
Identical sequences A0A098B604 B8FPV6
WP_015943624.1.13927 gi|219667771|ref|YP_002458206.1| 272564.Dhaf_1724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]