SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272564.Dhaf_1848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272564.Dhaf_1848
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily NE0471 N-terminal domain-like 0.000000000122
Family NE0471 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272564.Dhaf_1848
Sequence length 44
Comment (Desulfitobacterium hafniense DCB 2)
Sequence
MVPRPKEVKALENYCLQVFFENGETKIYDMPALLEMPFYSKLKN
Download sequence
Identical sequences B8FQJ9 G9XIH9
gi|219667890|ref|YP_002458325.1| 272564.Dhaf_1848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]