SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272564.Dhaf_2232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272564.Dhaf_2232
Domain Number 1 Region: 5-48
Classification Level Classification E-value
Superfamily UBA-like 0.000000055
Family UBA domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272564.Dhaf_2232
Sequence length 183
Comment (Desulfitobacterium hafniense DCB 2)
Sequence
MMTLLEKVEKLCSMGNITFEEAKAALDAANGDLLDAIIYLEKQGKIHAPAGGGYYNSEKT
VDAHVVSYQAKDWKHQNHGSDKENPFLSFCKDAWKLFVKLLRKGNANSFEVLHGEEVKGS
VPITALVLLLIFAFWVTIPLMVIGLFFGFRYRFVGTDIKGTTINDAMDSAADAAENLKKS
MDK
Download sequence
Identical sequences B8FSQ4
gi|219668266|ref|YP_002458701.1| WP_015943942.1.13927 272564.Dhaf_2232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]