SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272568.GDI_3172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272568.GDI_3172
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.88e-33
Family Ribosomal L27 protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272568.GDI_3172
Sequence length 89
Comment (Gluconacetobacter diazotrophicus PAl 5 FAPERJ)
Sequence
MAQKKAGGSSRNGRDSAGRRLGVKKFGGETVVAGNIIIRQRGTKMKPGSNVGLGRDHTIF
ALVDGHVKFERRAEGRVHVSVEALPVAAE
Download sequence
Identical sequences A9H0E8
gi|162148942|ref|YP_001603403.1| gi|162148942|ref|YP_001603403.1| 272568.GDI_3172 WP_012227566.1.42434 WP_012227566.1.67455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]