SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272569.pNG6157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272569.pNG6157
Domain Number 1 Region: 50-126
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000000114
Family Nickel responsive regulator NikR, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 1-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000000133
Family CopG-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272569.pNG6157
Sequence length 135
Comment (Haloarcula marismortui ATCC 43049)
Sequence
MRTSLNVSEDILEEFDETWQAEGLDSRSRAIREAMQEYIEGHSQLEEVSGEVVAVLAFDY
QHHEVIHDLHSAQHQFQDVIETMSHTHQGEWCLETVFCHGDAARVRELVYRLRDFDGVGR
VKTMLLRSTAPADPE
Download sequence
Identical sequences A0A1H6CD30 Q5V799
gi|55376549|ref|YP_134401.1| WP_011222470.1.11764 WP_011222470.1.16912 WP_011222470.1.33195 WP_011222470.1.34345 WP_011222470.1.69175 WP_011222470.1.70658 WP_011222470.1.95921 WP_011222470.1.98238 272569.pNG6157 gi|55376549|ref|YP_134401.1|NC_006394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]