SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272569.rrnAC0353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272569.rrnAC0353
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.53e-21
Family Chaperone J-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272569.rrnAC0353
Sequence length 219
Comment (Haloarcula marismortui ATCC 43049)
Sequence
MEATFYGILGVDPDATEETIVRAYREQTKAHHPDVSDDPAAGERFKRLTQAKNVLTDEAE
RARYDRLGHDAYVNRHVDSGADGGTATGGVSDIAQQYVDQRVDAETTDEAAAKATQRPTQ
TRGGSTGYGTATEYYRPGKRVRPTQPSGVETLLDSLRRIGPWLFVHLALLVCTIIAAVLL
AVGGLTGNLSPVVAGVMAVSMVTISLVVSATHVLTHVSG
Download sequence
Identical sequences M0KQU3 Q5V503
gi|55377255|ref|YP_135105.1| 272569.rrnAC0353 WP_007188423.1.69175 WP_007188423.1.84793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]