SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272620.KPN_00513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272620.KPN_00513
Domain Number 1 Region: 22-336
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.4e-101
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000814
Further Details:      
 
Domain Number 2 Region: 338-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-19
Family Glycosyl hydrolases family 32 C-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272620.KPN_00513
Sequence length 466
Comment (Klebsiella pneumoniae MGH 78578)
Sequence
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYAPQTMQADDGRRLLVGWMGV
PDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELVALRGEAQGWCGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAELHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVE
Download sequence
Identical sequences A0A2J2I3L2 A6T5U2
WP_012068387.1.17556 WP_012068387.1.18736 WP_012068387.1.26336 WP_012068387.1.38448 WP_012068387.1.49877 WP_012068387.1.60283 WP_012068387.1.72341 WP_012068387.1.86778 WP_012068387.1.87767 WP_012068387.1.96842 WP_012068387.1.97773 WP_012068387.1.98450 gi|152969084|ref|YP_001334193.1| 272620.KPN_00513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]