SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272620.KPN_01700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272620.KPN_01700
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.84e-46
Family D-ribulose-5-phosphate 3-epimerase 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272620.KPN_01700
Sequence length 218
Comment (Klebsiella pneumoniae MGH 78578)
Sequence
MDMMKLTEQLRFLNSKADRLHVDIMDGHYVKNLALSASFVAQIRPYTSLPIDVHLMVEAP
ASFIPALLDAGADAFSLHPETICREAFRVINMLRQAGKEVGMVLNPATPVESIQHYLHLL
DKVTVMTVDPGYAGQPFIPEMLAKITQLHQLKETGSLRFLLEVDGSCNRNTYRALLGAGA
QILVMGSSGLFRADMPLELAWETMSRELSAALHSPELV
Download sequence
Identical sequences A6T960 C8T9Q7
272620.KPN_01700 gi|152970252|ref|YP_001335361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]