SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272620.KPN_03423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272620.KPN_03423
Domain Number 1 Region: 6-293
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.14e-77
Family alpha-L-arabinanase-like 0.0000244
Further Details:      
 
Domain Number 2 Region: 309-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-22
Family Beta-D-xylosidase C-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272620.KPN_03423
Sequence length 507
Comment (Klebsiella pneumoniae MGH 78578)
Sequence
MTPSEYQNPILCADYSDPDIVRVGDDFFMVSSSFNHVPALPILHSTDLVNWTIINHVMDE
LPLPGYDRYQPGKGVWAPSIRWHDGKLWVCFSTPDEGIFICHTEDPWGKWSAPHCLREAR
GWIDPCPFWDDNGQAWLVHAFAHSRSGIKHKLQLFAMAPDASELLGEGQIIYDGCCDLPT
LEGPKVYQRAGWYYIFAPAGGVENGWQTVLRARQMTGPWEAKNVLFQGNTSINGPHQGGW
VEGEEGECWFVHFQDLHLYGRVVHLQPMSWGNDGWPRIGEQIGNCGVGQPVLRWPRPKGL
TPSPALAPQTSDYFAQGQPGIQWQWQANPSPEWLLPAEGELRLRCVPLSEVDGQRALYWA
PQLLLQKFPALTFSAKTSVTLYAAQDGDAGGLIVYGERYAALLVEFGQGGYRLVWRHGWM
SDAGVVRETRQVLAELKCGKCQLQVAVGEGGLCQFSWRAEEEWRKVPLCFAAGKGKWVGA
KFGLLAASMVGLQSEGYSALQDFEVIL
Download sequence
Identical sequences A0A2J5M6U5 A6TDZ8
272620.KPN_03423 gi|152971940|ref|YP_001337049.1| WP_009308665.1.10213 WP_009308665.1.10241 WP_009308665.1.12900 WP_009308665.1.13149 WP_009308665.1.13660 WP_009308665.1.14830 WP_009308665.1.16299 WP_009308665.1.18736 WP_009308665.1.20019 WP_009308665.1.22471 WP_009308665.1.24095 WP_009308665.1.24209 WP_009308665.1.25904 WP_009308665.1.25933 WP_009308665.1.26336 WP_009308665.1.2683 WP_009308665.1.27809 WP_009308665.1.29466 WP_009308665.1.29858 WP_009308665.1.31064 WP_009308665.1.34748 WP_009308665.1.3525 WP_009308665.1.38094 WP_009308665.1.38448 WP_009308665.1.39705 WP_009308665.1.40042 WP_009308665.1.4131 WP_009308665.1.41352 WP_009308665.1.42464 WP_009308665.1.43836 WP_009308665.1.44117 WP_009308665.1.47379 WP_009308665.1.49877 WP_009308665.1.50429 WP_009308665.1.50730 WP_009308665.1.50927 WP_009308665.1.51176 WP_009308665.1.55048 WP_009308665.1.55741 WP_009308665.1.5576 WP_009308665.1.56847 WP_009308665.1.60074 WP_009308665.1.66613 WP_009308665.1.66895 WP_009308665.1.68090 WP_009308665.1.68189 WP_009308665.1.7273 WP_009308665.1.73236 WP_009308665.1.76912 WP_009308665.1.78103 WP_009308665.1.78354 WP_009308665.1.80816 WP_009308665.1.83691 WP_009308665.1.8464 WP_009308665.1.85263 WP_009308665.1.8667 WP_009308665.1.86778 WP_009308665.1.87235 WP_009308665.1.89401 WP_009308665.1.89618 WP_009308665.1.90879 WP_009308665.1.91751 WP_009308665.1.925 WP_009308665.1.93502 WP_009308665.1.9511 WP_009308665.1.9521 WP_009308665.1.95927 WP_009308665.1.96842 WP_009308665.1.98450 WP_009308665.1.9996 388380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]