SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272621.LBA1787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272621.LBA1787
Domain Number - Region: 11-56
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0978
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272621.LBA1787
Sequence length 64
Comment (Lactobacillus acidophilus NCFM)
Sequence
MLYLIYIVLGLLIVLAVNYAVTAFLAVHDLLENREKDQLSFGDAFKKYFAKNNNIPTKFS
DLFN
Download sequence
Identical sequences Q5FI82
gi|488768514|ref|YP_007938611.1| WP_003549781.1.161 WP_003549781.1.23735 WP_003549781.1.25481 WP_003549781.1.35116 WP_003549781.1.39168 WP_003549781.1.44280 WP_003549781.1.4466 WP_003549781.1.47136 WP_003549781.1.60265 WP_003549781.1.63260 WP_003549781.1.66258 WP_003549781.1.68937 WP_003549781.1.73327 WP_003549781.1.74539 WP_003549781.1.75182 WP_003549781.1.76726 WP_003549781.1.79967 YP_194623.1.59247 272621.LBA1787 gi|58338038|ref|YP_194623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]