SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272622.LACR_0455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272622.LACR_0455
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-38
Family GHMP Kinase, N-terminal domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 170-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 5.47e-30
Family Mevalonate 5-diphosphate decarboxylase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272622.LACR_0455
Sequence length 318
Comment (Lactococcus lactis cremoris SK11)
Sequence
MKNIVTARAHTNIALIKYWGKTDIALNIPATSSLSMTLEPFYTTTSVEFTDNESDSLILN
SAMEDSSRVSKFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSASSFAALTAAMFGLLDL
EKDDSEMSRIARRGSGSASRSIFGNFAVWNKGENHQSSFAESFYNKDIGLSMIVAEISSE
KKKMSSTKGMQLAQTAPTYGAWVEKSAIQLAEMKQAILQADIEKVGLIAQDNALGMHEQN
RLCLEPFDYFTSETQRVVDFTKECYKAGLLAFVTIDAGPNVKIITDHATEKILLTKLKAE
FPELTFDIARAGGAYEYL
Download sequence
Identical sequences A0A1V0P7A6 Q031R3
272622.LACR_0455 WP_011675479.1.101083 WP_011675479.1.38190 WP_011675479.1.63588 WP_011675479.1.86027 gi|116511265|ref|YP_808481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]