SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272622.LACR_2047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272622.LACR_2047
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-46
Family Ribonuclease PH domain 1-like 0.0000305
Further Details:      
 
Domain Number 2 Region: 297-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-42
Family Ribonuclease PH domain 1-like 0.0000108
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.21e-28
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 4 Region: 142-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.97e-27
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 5 Region: 560-644
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.5e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 6 Region: 624-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.61e-21
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 
Domain Number 7 Region: 235-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000233
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272622.LACR_2047
Sequence length 769
Comment (Lactococcus lactis cremoris SK11)
Sequence
MAKETFSIEFAGRTLTVETGQVAKQANGAVVVRYGDTTVLTAATMGKMATGDFFPLQVNY
EEKMYAAGKFPGGFNKREARPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDEN
ASGRVAAMFGSSLALAISDIPFDGPIAGVEVAYIDGKYVINPTVAEKESSSLELSVAGNI
NAINMVESGAKELSEEVMLGALLAGHNAVKELIEFQNEIVAKVGKEKAEVELLHVDEDLK
AEVIAAYNSDLQKAVQVEEKLAREAATKAVKEAIISVYSAKYENDENLSIILRDLAEILE
GMEHAEVRRLITEDKIRPDGRKIDEIRPLDAEIDFTPRSITHGTGLFTRGQTQALSTLTL
APMNEAQIIDGLNDEYKKRFMHHYNFPQYSVGETGRYGAPGRREIGHGALGERALEQVLP
SLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYT
VLTDIQGLEDHFGDMDFKVAGTREGITALQMDIKISGITPEILAEALAQAKTARFQILDV
IEATIAQPREELAPSAPKIDTIMIPVDKIKVVIGKGGEQIDKIIAETGVKIDIDDEGLCS
IFSSDQSAIDRAKEIIAELVREAKVGEVYEAKVVRIESFGAFVNLFGKQDAMVHISEMAW
ARTAKVEDVMKLGDVVKVKIMKIDDKGRVDASMRALVEKPEGYVEPERKPRERRDNKDRR
NGNGFDRRNNDRNNHNNHNNNSGNHSFELRERKSHVDHEFPELSTKKPE
Download sequence
Identical sequences A0A1V0PJL2 Q02WZ5
gi|116512733|ref|YP_811640.1| WP_011676867.1.101083 WP_011676867.1.11522 WP_011676867.1.22176 WP_011676867.1.38018 WP_011676867.1.38190 WP_011676867.1.63588 WP_011676867.1.6822 WP_011676867.1.81028 WP_011676867.1.86027 272622.LACR_2047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]