SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272622.LACR_2159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272622.LACR_2159
Domain Number 1 Region: 336-474
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.46e-27
Family HD domain 0.027
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.95e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272622.LACR_2159
Sequence length 531
Comment (Lactococcus lactis cremoris SK11)
Sequence
MDIISIVLLVLLVVLVVAFIFCAQNIKKNKQDAESLFNEAENKANEVMASAKREAESLKR
EAEAFKKEARYTLREEEQKQRREIEDEFKQERQELKETEKRLKQREEILDRKDDTLTKKE
ENLDSKEENLVRKTDTLSKREEQLAHIEEKKRLELERISNLSMDDAREIILSETRDGLTK
EMAQTIRQSEEKAQAEADKRAKNIISLAIQRVSSDSVAEQTVSVVNLPDDGMKGRIIGRE
GRNIRTFEALTGIDVIIDDTPEAVVLSGFDPIRREIARMTLEQLVQDGRIHPARIEELVE
KNRKALDHKMREYGEQAAFEVGAHNLHPDLMKIMGRLHFRTSYGQNVLDHSVEVAHIAGN
LAGEMGENEALAKRAGFLHDIGKALDHEVEGSHVEIGTELARKYKENPIVINTIASHHGD
TEPLSNIAVLVAAADALSAARPGARRESIENYIKRLKDLEAISTSFDGVETAFALQAGRE
IRVMVKPDKLTDDQIVILARDVKNRIEDEMDYPGNIKVTVIRETRAIDYAK
Download sequence
Identical sequences A0A1V0PBT8 Q02WP0
WP_011676969.1.101083 WP_011676969.1.38190 WP_011676969.1.63588 WP_011676969.1.86027 272622.LACR_2159 gi|116512838|ref|YP_811745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]