SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272623.L0234 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272623.L0234
Domain Number 1 Region: 4-321
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.28e-92
Family alpha-L-arabinanase-like 0.0000000114
Further Details:      
 
Domain Number 2 Region: 331-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-59
Family Beta-D-xylosidase C-terminal domain-like 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272623.L0234
Sequence length 559
Comment (Lactococcus lactis)
Sequence
MSLIQNPILPGFNADPSIIRVEDTYYIANSTFEWFPGVRLHESKDLEHWSLLPSPLSTTT
LLDMRGNSASGGIWAPDLSYADGKFWLVYTDVKVVNGAFKDMTNYLTTATDIKGPWTDPI
KLNGLGFDASLFHDKDGRKYLVQQTWDHREYKHPFDGITLTEFDMTTMKLQPKKAKTIYN
GTNVKLVEGPHLYQINDYYYLFAAQGGTVFTHQEVVARSKTLDTLSFETEPGDPFITNFD
TPDNYIQKQGHGGLVSTPKGEWYYASLCARPWNHKNESSTDPRGWSSLGRETSIQKVEWD
EEGWPRIVGGHGGTTFVEGPKDAIQTNAPAEHSQKDDFASSTLDINWNTLRVPFTEKMGS
VGNGKLTLIGQGSLANNFDLSLIARRWQAFYFDAEVKVKFDPFSYQQMAGLTNYYNDRHW
SFVFITWNEVNGAVIEVAENNRGNYTSYLKDNAIKIPDGTEYVWFRTKVRKESYSYEYSF
DGKKFIEIPVVLDAAVLSDDYVLQTYGGFFTGAFVGLAAVDYSGYDRVAEFYNFDYKELG
DKVLPDGSYTWKASESRFD
Download sequence
Identical sequences Q9CFH1
272623.L0234 NP_267661.1.16647 gi|15673487|ref|NP_267661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]