SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272623.L150593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272623.L150593
Domain Number 1 Region: 336-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.32e-27
Family HD domain 0.021
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.95e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272623.L150593
Sequence length 531
Comment (Lactococcus lactis)
Sequence
MDIISIVLLVLLVVLVVAFIFYAQNIKKNKQDAESLFNEAENKANEVMANAKREAESLKM
EAEAFKKEARYTLREEEQKQRREIEDEFKQERQELKETEKRLKQREEILDRKDDTLTKKE
ENLDSKEENLVRKTDTLSKREEQLAHIEEKKRLELERISNLSTDDAREIILSETRDGLTK
EMAQIIRQSEEKAQVEADKRAKNIISLAIQRVSSDSVAEQTVSVVNLPDDGMKGRIIGRE
GRNIRTFEALTGIDVIIDDTPEAVVLSGFDPIRREIARMTLEQLVQDGRIHPARIEELVE
KNRKALDHKMREYGEQAAFEVGAHNLHPDLMKIMGRLHFRTSYGQNVLDHSVEVAHIAGN
LAGEMGENVALAKRAGFLHDIGKALDHEVEGSHVEIGTELARKYKENPIVINTIASHHGD
TEPLSNIAVLVAAADALSAARPGARRESIENYIKRLKDLEAISTSFEGVETAFALQAGRE
IRVMVKPEKLTDDQIVILARDVKNRIEDEMDYPGNIKITVIRETRAIDYAK
Download sequence
Identical sequences A0A089XTB7 A0A0H1RKC1 A0A199YVG5 D2BLL8 G6FDI2 Q9CEE2 S6FLI9 T0VAN3 U5PQJ9
272623.L150593 684738.LLKF_2093 NP_268057.1.16647 WP_003131467.1.1423 WP_003131467.1.15553 WP_003131467.1.22261 WP_003131467.1.24694 WP_003131467.1.28005 WP_003131467.1.30056 WP_003131467.1.32081 WP_003131467.1.32884 WP_003131467.1.35037 WP_003131467.1.35288 WP_003131467.1.39480 WP_003131467.1.39902 WP_003131467.1.41962 WP_003131467.1.4910 WP_003131467.1.49120 WP_003131467.1.49519 WP_003131467.1.5208 WP_003131467.1.52093 WP_003131467.1.55618 WP_003131467.1.56612 WP_003131467.1.60011 WP_003131467.1.61814 WP_003131467.1.62525 WP_003131467.1.6264 WP_003131467.1.6372 WP_003131467.1.69015 WP_003131467.1.70621 WP_003131467.1.70979 WP_003131467.1.71573 WP_003131467.1.7442 WP_003131467.1.77362 WP_003131467.1.8561 WP_003131467.1.89978 WP_003131467.1.90754 WP_003131467.1.91600 WP_003131467.1.92818 WP_003131467.1.95624 WP_003131467.1.96756 WP_003131467.1.96923 WP_003131467.1.97467 WP_003131467.1.98285 KR93 gi|15673882|ref|NP_268057.1| gi|385831445|ref|YP_005869258.1| gi|281492513|ref|YP_003354493.1| gi|554464485|ref|YP_008703631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]