SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272624.lpg0613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272624.lpg0613
Domain Number - Region: 20-68
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00419
Family SPRY domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272624.lpg0613
Sequence length 107
Comment (Legionella pneumophila Philadelphia 1)
Sequence
MVRIFLLALGLFSSTTINAWYGSGITIGVARANVHYYGDDIRVYDPWGYGYYDRNYYYNG
VRNIIVPSVIVPNVVINVPVQRYYVPSCEEMEVCDPYGQCWLEQFCR
Download sequence
Identical sequences A0A2J9NMS7 Q5ZXW8
272624.lpg0613 WP_010946350.1.100609 WP_010946350.1.100881 WP_010946350.1.101326 WP_010946350.1.101385 WP_010946350.1.11666 WP_010946350.1.1173 WP_010946350.1.1188 WP_010946350.1.12035 WP_010946350.1.12661 WP_010946350.1.14235 WP_010946350.1.15016 WP_010946350.1.15769 WP_010946350.1.16078 WP_010946350.1.16593 WP_010946350.1.16748 WP_010946350.1.16962 WP_010946350.1.17809 WP_010946350.1.17857 WP_010946350.1.19321 WP_010946350.1.19554 WP_010946350.1.19781 WP_010946350.1.20369 WP_010946350.1.2062 WP_010946350.1.2085 WP_010946350.1.21466 WP_010946350.1.21493 WP_010946350.1.22734 WP_010946350.1.22766 WP_010946350.1.23459 WP_010946350.1.24053 WP_010946350.1.24333 WP_010946350.1.2441 WP_010946350.1.24636 WP_010946350.1.25422 WP_010946350.1.26718 WP_010946350.1.27501 WP_010946350.1.27674 WP_010946350.1.28040 WP_010946350.1.28814 WP_010946350.1.30351 WP_010946350.1.30583 WP_010946350.1.30653 WP_010946350.1.30822 WP_010946350.1.3122 WP_010946350.1.31291 WP_010946350.1.3258 WP_010946350.1.32659 WP_010946350.1.35118 WP_010946350.1.35787 WP_010946350.1.35807 WP_010946350.1.36016 WP_010946350.1.36420 WP_010946350.1.37108 WP_010946350.1.37161 WP_010946350.1.37274 WP_010946350.1.37932 WP_010946350.1.3819 WP_010946350.1.38679 WP_010946350.1.38809 WP_010946350.1.39582 WP_010946350.1.41185 WP_010946350.1.41378 WP_010946350.1.41396 WP_010946350.1.41414 WP_010946350.1.41486 WP_010946350.1.43838 WP_010946350.1.44619 WP_010946350.1.44866 WP_010946350.1.44947 WP_010946350.1.45039 WP_010946350.1.46042 WP_010946350.1.46096 WP_010946350.1.46375 WP_010946350.1.46948 WP_010946350.1.47638 WP_010946350.1.47823 WP_010946350.1.47956 WP_010946350.1.48346 WP_010946350.1.48987 WP_010946350.1.49562 WP_010946350.1.50379 WP_010946350.1.51153 WP_010946350.1.51428 WP_010946350.1.51956 WP_010946350.1.52283 WP_010946350.1.52706 WP_010946350.1.52905 WP_010946350.1.53250 WP_010946350.1.53443 WP_010946350.1.53795 WP_010946350.1.53844 WP_010946350.1.54355 WP_010946350.1.54450 WP_010946350.1.547 WP_010946350.1.5553 WP_010946350.1.57055 WP_010946350.1.57468 WP_010946350.1.58425 WP_010946350.1.58541 WP_010946350.1.58606 WP_010946350.1.58655 WP_010946350.1.59183 WP_010946350.1.59227 WP_010946350.1.59576 WP_010946350.1.60239 WP_010946350.1.60770 WP_010946350.1.61482 WP_010946350.1.61895 WP_010946350.1.62255 WP_010946350.1.63282 WP_010946350.1.63357 WP_010946350.1.636 WP_010946350.1.64335 WP_010946350.1.64388 WP_010946350.1.64512 WP_010946350.1.64714 WP_010946350.1.64856 WP_010946350.1.65604 WP_010946350.1.6601 WP_010946350.1.66209 WP_010946350.1.66299 WP_010946350.1.66942 WP_010946350.1.67348 WP_010946350.1.68412 WP_010946350.1.69197 WP_010946350.1.69880 WP_010946350.1.70346 WP_010946350.1.71556 WP_010946350.1.72557 WP_010946350.1.728 WP_010946350.1.73029 WP_010946350.1.73276 WP_010946350.1.73409 WP_010946350.1.73915 WP_010946350.1.74197 WP_010946350.1.74438 WP_010946350.1.75016 WP_010946350.1.75353 WP_010946350.1.75911 WP_010946350.1.76298 WP_010946350.1.76893 WP_010946350.1.77360 WP_010946350.1.77472 WP_010946350.1.77852 WP_010946350.1.77866 WP_010946350.1.79027 WP_010946350.1.79030 WP_010946350.1.79423 WP_010946350.1.79768 WP_010946350.1.80208 WP_010946350.1.80678 WP_010946350.1.80733 WP_010946350.1.80817 WP_010946350.1.81040 WP_010946350.1.81849 WP_010946350.1.81970 WP_010946350.1.82765 WP_010946350.1.82883 WP_010946350.1.83499 WP_010946350.1.8363 WP_010946350.1.84032 WP_010946350.1.8407 WP_010946350.1.84081 WP_010946350.1.85699 WP_010946350.1.86349 WP_010946350.1.86607 WP_010946350.1.87656 WP_010946350.1.89129 WP_010946350.1.89135 WP_010946350.1.89155 WP_010946350.1.89171 WP_010946350.1.90392 WP_010946350.1.91040 WP_010946350.1.91183 WP_010946350.1.91256 WP_010946350.1.91480 WP_010946350.1.93200 WP_010946350.1.94262 WP_010946350.1.95686 WP_010946350.1.96018 WP_010946350.1.96370 WP_010946350.1.97528 WP_010946350.1.97635 WP_010946350.1.97946 WP_010946350.1.98470 WP_010946350.1.98928 YP_094649.1.86292 gi|52840850|ref|YP_094649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]