SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272626.lin0572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin0572
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.26e-83
Family Histidine biosynthesis enzymes 0.0000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272626.lin0572
Sequence length 251
Comment (Listeria innocua)
Sequence
MLTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQ
TMIDVVERTAEQVFIPLTVGGGINSVNDMKELLQAGADKISLNSAAIKRPELIQEGANKF
GNQCIVVAIDAKWNGSNWHVFTRGGRDDTGLDAIEWAKKATQLGAGEILLTSMDGDGTKN
GYDIPLTKAISEAVSVPVIASGGCGNASHMVEVFEQTNATAALAASIFHYGELSIKNVKT
TLLEKGVNIRP
Download sequence
Identical sequences Q92E88
WP_003760706.1.46653 WP_003760706.1.51650 WP_003760706.1.67429 WP_003760706.1.70104 WP_003760706.1.83607 272626.lin0572 gi|16799647|ref|NP_469915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]