SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272626.lin1522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin1522
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.35e-33
Family HD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272626.lin1522
Sequence length 191
Comment (Listeria innocua)
Sequence
MERNEVLKKVEEAMPTARFKHTLGVEKAAIELAEHYHMDIEKARITALLHDYAKYYEDDK
ARKIIEDEGFDPRLLQFHRSLWHAPVGAYLAEKEFGITDPEILEAIRLHTTGSGAMSDFD
KLIYLADYTEPGRTFPGVYKARRLALKSLDAAMLFALSNTITYLIKKQQSVFPDTLDAYN
YFVNLNLEGDY
Download sequence
Identical sequences H1GDQ7 Q92BM6
gi|16800590|ref|NP_470858.1| WP_003771898.1.46653 WP_003771898.1.51650 WP_003771898.1.99521 WP_003771898.1.99921 272626.lin1522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]